The URL can be used to link to this page

2023-10-03 CC packet REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 1 of 11 REGULAR CITY COUNCIL MEETING MINUTES SEPTEMBER 19, 2023 LOCATION: 1400 Main Street, Southlake, Texas 76092 Council Chambers in Town Hall CITY COUNCIL PRESENT: Mayor John Huffman, Mayor Pro Tem Shawn McCaskill, Deputy Mayor Pro Tem Kathy Talley, and Councilmembers Randy Robbins, Ronell Smith, and Randy Williamson CITY COUNCIL ABSENT: Councilmember Amy Torres-Lepp STAFF PRESENT: City Manager Shana Yelverton, Assistant City Manager Alison Ortowski, Assistant to the City Manager Major Youngblood, Senior Director of Human Resources Stacey Black, Director of Communications Pilar Schank, Chief Financial Officer Sharen Jackson, Police Chief James Brandon, Fire Chief Mike Starr, Director of Community Services Chris Tribble, Operations Manager of Special Projects Robert Briggs, Operations Manager of Customer Service Melody Anderson, Tourism Marketing Manager Hillary Cromer, Director of Planning and Development Services Dennis Killough, Director of Public Works Rob Cohen, City Attorney Allen Taylor, and City Secretary Amy Shelley. WORK SESSION: 1. CALL TO ORDER Work Session was called to order by Mayor John Huffman at 5:30pm. 2. INVOCATION: CLAYTON REED Mr. Clayton Reed provided the invocation. Mayor John Huffman led the pledges of allegiance to the United States and Texas Flags. 3. SISTER CITIES TOME EXCHANGE UPDATE Deputy City Secretary Veronica Lomas introduced the Southlake Sister Cities Youth Ambassadors Alison Bedwell and Kate Ponzo, who provided an update to the City Council about the June 2023 Tome trip. 4. SOUTHLAKE CHAMBER OF COMMERCE UPDATE ITEM 4A REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 2 of 11 Southlake Chamber of Commerce Incoming Chair Kush Rao provided the Chamber update. 5. DISCUSS ALL ITEMS ON TONIGHT'S AGENDA. NO ACTION WILL BE TAKEN AND EACH ITEM WILL BE CONSIDERED DURING THE REGULAR SESSION. Mayor Huffman reviewed the items on the consent agenda. REGULAR SESSION: Immediately following the work session 1. CALL TO ORDER Regular Session was called to order by Mayor Huffman at 5:52pm. 2A. EXECUTIVE SESSION Mayor Huffman announced the City Council would go into Executive Session pursuant to the Open Meetings Act, Chapter 551, Texas Government Code, Section 551.071 consultation with city attorney; Section 551.072 deliberation regarding real property; and Section 551.087 deliberation regarding economic development negotiations. City Council adjourned for Executive Session at 5:52pm. Executive Session began at 6:11pm and concluded at 7:06pm. 2B. RECONVENE Mayor Huffman reconvened the meeting at 7:14pm. 3. REPORTS: 3A. MAYOR’S REPORT Mayor Huffman invited everyone to attend the State of the City scheduled for Thursday, September 21, 2023 at 5:30pm at The Marq. 3B. CITY MANAGER’S REPORT 3B1. CHRIS TRIBBLE RETIREMENT City Manager Shana Yelverton spoke about Mr. Tribble’s retirement and this 17-year tenure with the City. The Mayor and Council expressed their appreciation for his service to the City and wished him well in his retirement. Mr. Tribble expressed his appreciation to the Mayor and Council, Mrs. Yelverton and the Executive Leadership Team for allowing him to serve the wonderful community of Southlake. 3B2. MONTHLY FINANCIAL REPORT (WRITTEN) REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 3 of 11 CONSENT AGENDA: All items listed below are considered to be routine by the City Council and will be enacted with one motion. There will be no separate discussion of items unless a Councilmember or citizen so requests, in which event the item will be removed from the general order of business and considered in its normal sequence. 4. CONSENT: 4A. APPROVE MINUTES FROM THE SEPTEMBER 5, 2023, REGULAR CITY COUNCIL MEETING. 4B. EXCUSE COUNCILMEMBER AMY TORRES-LEPP FROM THE SEPTEMBER 19, 2023, REGULAR CITY COUNCIL MEETING. 4C. CANCEL THE NOVEMBER 21, 2023, REGULAR CITY COUNCIL MEETING. 4D. APPROVE THE MOU BETWEEN THE CITY OF SOUTHLAKE AND THE KELLER INDEPENDENT SCHOOL DISTRICT TO PROVIDE AN SRO FOR FLORENCE ELEMENTARY. 4E. APPROVE ANNUAL CONTRACT RENEWAL FOR DISASTER DEBRIS REMOVAL AND DISPOSAL SERVICES FOR D&J ENTERPRISES PRIMARY AWARD, AND DRC EMERGENCY SERVICES AND TFR ENTERPRISES AS SECONDARY AWARDS. 4F. APPROVE CONTRACT AWARD FOR EMERGENCY BULK DRINKING WATER SERVICES TO LIPSEY TRUCKING. 4G. RESOLUTION NO. 23-021, ANNUAL REVIEW OF INVESTMENT POLICY AND INVESTMENT STRATEGIES. 4H. AUTHORIZE EXPENDITURES WITH VERITIV CORP FOR JANITORIAL SUPPLIES IN AN AMOUNT NOT TO EXCEED $60,000. 4I. APPROVE A ONE-YEAR PLAT EXTENSION OF THE VALIDITY OF CASE ZA22-0040, PLAT REVISION FOR LOT 14R OF THE HILLTOP ACRES ADDITION, BEING A REVISION OF LOT 14, HILLTOP ACRES ADDITION, AN ADDITION TO THE CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS, AND INCLUDING A 0.116 ACRE TRACT OF LAND IN THE DAVID DOUTHIT SURVEY, ABSTRACT NO. 446, SOUTHLAKE, TARRANT COUNTY, TEXAS AND LOCATED AT 4021 HILLTOP DRIVE, SOUTHLAKE, TEXAS. 4J. ORDINANCE NO. 480-807, ZA23-0048, 1ST READING, ZONING CHANGE AND CONCEPT PLAN FOR 1584 RANDOL MILL AVE., FOR PROPERTY DESCRIBED AS TRACT 1B, WILLIAM WINN SURVEY ABSTRACT NO. 1660, CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS AND LOCATED AT 1584 RANDOL MILL AVE, SOUTHLAKE, TEXAS. CURRENT ZONING: “AG” REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 4 of 11 AGRICULTURAL DISTRICT. PROPOSED ZONING: “SF-30” SINGLE FAMILY RESIDENTIAL DISTRICT. SPIN NEIGHBORHOOD # 5. 4K. EXCUSE PLANNING AND ZONING COMMISSIONER MICHAEL SPRINGER FROM THE SEPTEMBER 7, 2023, REGULAR PLANNING AND ZONING COMMISSION MEETING. 4L. APPROVE A CONTRACT WITH BOWMEN SPORTS IN AN AMOUNT NOT TO EXCEED $80,000 FOR CONTRACT PROGRAMMING SERVICES AT CHAMPIONS CLUB. 4M. ORDINANCE NO. 1278, 1ST READING, DEDICATING A SANITARY SEWER EASEMENT AND A TEMPORARY CONSTRUCTION EASEMENT TO TRINITY RIVER AUTHORITY (TRA) ON LOT 30, BLOCK 1, KIRKWOOD HOLLOW ADDITION, BEING LOCATED AT 3000 N. WHITE CHAPEL BLVD. 4N. RESOLUTION NO. 23-018, AMENDING THE FEE SCHEDULE. APPROVED Motion was made to approve Consent Items 4A-4N, as written, including moving Items 6C and 6E from the Regular Agenda to the Consent Agenda, and noting the following: - Item 6C – APROVING - Resolution No. 23-022, authorizing purchases for the 2024 Fiscal Year and authorizing the City Manager to enter into contracts necessary to effectuate said purchases; and - Item 6E – DENYING - Ordinance No. 480-564F, ZA23-0045, 2nd Reading, Zoning Change and Development Plan for Carillon Parc on property described as Tracts 1, 1D, 1E, 1F, 1G, 3A, 3A01, 3A03, 3A04, 3A04A, 3A05, and 3A01B, Larkin H. Chivers Survey, Abstract No. 300, City of Southlake, Tarrant County, Texas and located at 1775, 1781 and 1801 N. White Chapel Blvd., 1840 Riviera Ln., 201 E. Kirkwood Blvd., 1700 N. Carroll Ave. (addressed as 1900 N. Carroll Ave. by Tarrant Appraisal District) and 100 through 300 E. State Hwy. 114, generally located east of N. White Chapel Blvd., south of E. Kirkwood Blvd., west of Riviera Ln., and north of E. State Hwy. 114. Motion: McCaskill Second: Talley Ayes: Talley, Robbins, McCaskill, Huffman, Smith, Williamson Nays: None Absent: Torres-Lepp Approved: 6-0 REGULAR AGENDA: 5. PUBLIC FORUM Mayor Huffman opened the public forum at 7:31pm. REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 5 of 11 Patty Minder, 223 Eastwood Dr., spoke about a traffic signal status update. Mayor Huffman explained that staff would follow up with her about her question. There being no one else wishing to speak, Mayor Huffman closed the public forum at 7:33pm. 6. ORDINANCES, SECOND READINGS, PUBLIC HEARINGS, AND RELATED ITEMS: 6A. ORDINANCE NO. 1277, 2ND READING, TAX LEVY ORDINANCE. PUBLIC HEARING APPROVED Chief Financial Officer Sharen Jackson presented Item 6A and answered questions from Council. Mayor Huffman opened the public hearing at 7:37pm. There being no one wishing to speak, Mayor Huffman closed the public hearing at 6:37pm. Motion was made to approve Item 6A, Ordinance No. 1277, 2nd Reading, Tax Levy Ordinance. Motion: McCaskill Second: Talley Ayes: Talley, Robbins, McCaskill, Huffman, Smith, Williamson Nays: None Absent: Torres-Lepp Approved: 6-0 ORDINANCE NO. 1277 AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS, FIXING AND LEVYING MUNICIPAL AD VALOREM TAXES FOR THE FISCAL YEAR BEGINNING OCTOBER 1, 2023 AND ENDING SEPTEMBER 30, 2024, AND FOR EACH YEAR THEREAFTER UNTIL OTHERWISE PROVIDED, AT THE RATE OF $0.319 PER ONE HUNDRED DOLLARS ($100.00) ASSESSED VALUE ON ALL TAXABLE PROPERTY WITHIN THE CORPORATE LIMITS OF THE CITY OF SOUTHLAKE, TEXAS, AS OF JANUARY 1, 2023, TO PROVIDE REVENUES FOR THE PAYMENT OF CURRENT EXPENSES AND TO PROVIDE AN INTEREST AND SINKING FUND ON ALL OUTSTANDING DEBTS OF THE CITY; DIRECTING THE ASSESSMENT THEREOF; PROVIDING FOR DUE AND DELINQUENT DATES TOGETHER WITH PENALTIES AND INTEREST THEREON; PROVIDING FOR PLACE OF PAYMENT; PROVIDING FOR APPROVAL OF THE TAX ROLLS PRESENTED TO THE CITY COUNCIL; PROVIDING FOR THE REPEAL OF INCONSISTENT ORDINANCES; REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 6 of 11 PROVIDING FOR A SEVERABILITY CLAUSE; AND DECLARING AN EFFECTIVE DATE. 6B. ORDINANCE NO. 1276, 2ND READING, APPROVING AND ADOPTING THE ANNUAL BUDGET FOR FISCAL YEAR 2024, AND APPROVING THE REVISED BUDGET FIGURES FOR FISCAL YEAR 2023. PUBLIC HEARING APPROVED Chief Financial Officer Sharen Jackson presented Item 6B and answered questions from Council. Mayor Huffman opened the public hearing at 7:38pm. There being no one wishing to speak, Mayor Huffman closed the public hearing at 6:38pm. Motion was made to approve Item 6B, Ordinance No. 1276, 2nd Reading, approving and adopting the Annual Budget for Fiscal Year 2024, and approving the revised budget figures for Fiscal Year 2023. Motion: McCaskill Second: Talley Ayes: Talley, Robbins, McCaskill, Huffman, Smith, Williamson Nays: None Absent: Torres-Lepp Approved: 6-0 ORDINANCE NO. 1276 AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS, APPROVING REVISED BUDGET FIGURES FOR FISCAL YEAR 2023; APPROVING AND ADOPTING THE BUDGET FOR THE FISCAL YEAR BEGINNING OCTOBER 1, 2023, AND TERMINATING SEPTEMBER 30, 2024, AND MAKING APPROPRIATIONS FOR EACH DEPARTMENT, PROJECT, AND ACCOUNT; REPEALING CONFLICTING ORDINANCES; PROVIDING A SAVINGS AND SEVERABILITY CLAUSE; AND DECLARING AN EFFECTIVE DATE. 6C. RESOLUTION NO. 23-022, AUTHORIZING PURCHASES FOR THE 2024 FISCAL YEAR AND AUTHORIZING THE CITY MANAGER TO ENTER INTO CONTRACTS NECESSARY TO EFFECTUATE SAID PURCHASES. APPROVED UNDER CONSENT 6D. ZA23-0049, SITE PLAN FOR CONSTELLATION SOUTHLAKE, FOR PROPERTY DESCRIBED AS TRACTS 1B01, 1B01B 1B01C, 1B01C1, 1B01C2, 1B01D, HARRISON DECKER SURVEY ABSTRACT NO. 438, CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS AND LOCATED AT 2100-2120 REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 7 of 11 MUSTANG COURT, SOUTHLAKE, TEXAS. CURRENT ZONING: “I-2” HEAVY INDUSTRIAL DISTRICT. SPIN NEIGHBORHOOD #8. PUBLIC HEARING APPROVED Director of Planning and Development Services Dennis Killough presented Item 6D and answered questions from Council. Mayor Huffman opened the public hearing at 7:46pm. There being no one wishing to speak, Mayor Huffman closed the public hearing at 7:46pm. Motion was made to approve Item 6D, ZA23-0049, Site Plan for Constellation Southlake, for property described as Tracts 1B01, 1B01B 1B01C, 1B01C1, 1B01C2, 1B01D, Harrison Decker Survey Abstract No. 438, City of Southlake, Tarrant County, Texas and located at 2100-2120 Mustang Court, Southlake, Texas, subject to Staff Report dated September 12, 2023, and Site Plan Review Summary No. 2, dated September 7, 2023, and noting the following: - The proposed tree conservation does not comply with the existing tree cover preservation requirements. There is 22.95% of existing tree cover on the site, and a minimum of 60% of the existing tree cover is required to be preserved. A total of 0% of the existing tree cover is proposed to be preserved. - Approving the tree preservation variance as presented. Motion: McCaskill Second: Talley Ayes: Talley, Robbins, McCaskill, Huffman, Smith, Williamson Nays: None Absent: Torres-Lepp Approved: 6-0 6E. ORDINANCE NO. 480-564F, ZA23-0045, 2ND READING, ZONING CHANGE AND DEVELOPMENT PLAN FOR CARILLON PARC ON PROPERTY DESCRIBED AS TRACTS 1, 1D, 1E, 1F, 1G, 3A, 3A01, 3A03, 3A04, 3A04A, 3A05, AND 3A01B, LARKIN H. CHIVERS SURVEY, ABSTRACT NO. 300, CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS AND LOCATED AT 1775, 1781 AND 1801 N. WHITE CHAPEL BLVD., 1840 RIVIERA LN., 201 E. KIRKWOOD BLVD., 1700 N. CARROLL AVE. (ADDRESSED AS 1900 N. CARROLL AVE. BY TARRANT APPRAISAL DISTRICT) AND 100 THROUGH 300 E. STATE HWY. 114, GENERALLY LOCATED EAST OF N. WHITE CHAPEL BLVD., SOUTH OF E. KIRKWOOD BLVD., WEST OF RIVIERA LN., AND NORTH OF E. STATE HWY. 114. SPIN NEIGHBORHOOD #3. PUBLIC HEARING (THIS ITEM WAS DENIED ON THE FIRST READING AND A PUBLIC HEARING WAS ADVERTISED FOR THE SECOND READING TO BE HELD ON SEPTEMBER 19, 2023. THE APPLICANT HAS REQUESTED THIS ITEM BE WITHDRAWN.) REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 8 of 11 DENIED UNDER CONSENT 7. ORDINANCES, FIRST READINGS, AND RELATED ITEMS: 7A. ORDINANCE NO. 1269A, CP23-0001, 1ST READING, AMENDMENT TO THE CITY OF SOUTHLAKE CONSOLIDATED FUTURE LAND USE PLAN, AN ELEMENT OF THE SOUTHLAKE COMPREHENSIVE PLAN, FOR 2185 E. SOUTHLAKE BLVD. (FLOOR AND DÉCOR) FOR PROPERTY DESCRIBED AS TRACT 1B02, JOHN A FREEMAN SURVEY ABSTRACT NO. 529, CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS AND LOCATED AT 2185 E. SOUTHLAKE BLVD., SOUTHLAKE, TEXAS. CURRENT LAND USE DESIGNATION: RETAIL COMMERCIAL AND OFFICE COMMERCIAL. REQUESTED LAND USE DESIGNATION: RETAIL COMMERCIAL AND OFFICE COMMERCIAL WITH A SITE-SPECIFIC RECOMMENDATION. SPIN NEIGHBORHOOD #8. DENIED Director of Planning and Development Services Dennis Killough presented Item 7A and answered questions from Council. Although not required, Mayor Huffman opened a public hearing at 8:42pm. The following persons spoke in opposition to this request: Dennis Minder, 223 Eastwood Dr. Carl Sledz, 220 Eastwood Dr. Betsy Williford, 225 Eastwood Dr. Cam Bryan, 970 Ownby Ln. Pattie Minder, 223 Eastwood Dr. The following persons did not wish to speak, but wished to register their support: Lindsey Castner, 1215 Concord Ave. Katie Carpenter, 1315 Bent Creek Dr. Darcy Bieszczad, 517 Bluffview Terrace Ginny Young, 1100 La Paloma Ct. Marissa Mahon, 2949 River Crest St, Grapevine Jacque Baughman, 1103 Versailles Ct. Gina Crosby, 1221 Forest Hills Dr. Nancy Morgan, 1356 Lakeview Dr. Heath Niemi, 805 Worthing Ct. John Schindler, 804 Parkdale Ct. Jennifer Stapleton, 401 Bryn Meadows Jason Wang, 721 Winding Ridge Trl. Jason & Betsy Williford, 225 Eastwood Dr. Randy & Connie Woertendyke, 917 Edgemeer Ln. Marlene Bopp, 807 Aberdeen Way Gerald & Loretta Brennan, 1105 Corckett Ct. Kate Douglas, 703 Chaucer Ct. REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 9 of 11 Carrie Kehres, 610 Logans Ln. Meghan Kinslow, 2054 Miracle Pointe Dr. Melinda Luber, 2106 Miracle Pointe Dr. Melissa McIntyre, 1340 Bent Trail Cr. Larissa Milby, 1212 Clubhouse Ct. Mario Montemayor, 1234 Timberline Ct. Erin Murnighan, 723 Wyndsor Creek Dr. Madison Orser, 1017 South Hollow Dr. Irene Sanchez, 1304 Forest Hills Ct. Lindsay Terry, 1355 Cross Timber Dr. Danielle Tucker, 709 Kent Ct. Dulce Hardin, 1301 Forest Hills Ct. Rebecca Zawisky, 2046 Miracle Point Dr. Cindy Grossman, 217 Westwood Dr. Ann Leavens, 220 Westwood Dr. Alexandra Brice, 1115 Calais Dr. John & Beverly Reymal, 204 Westwood Dr. Michael & Laura Heath, 211 Westwood Dr. Ray & Donna Grupp, 222 Westwood Dr. There being no one else wishing to speak, Mayor Huffman closed the public hearing at 9:00pm. Motion was made to DENY Item 7A, Ordinance No. 1269A, CP23-0001, 1st Reading, amendment to the City of Southlake Consolidated Future Land Use Plan, an Element of the Southlake Comprehensive Plan, for 2185 E. Southlake Blvd. (Floor and Décor) for property described as Tract 1B02, John A Freeman Survey Abstract No. 529, City of Southlake, Tarrant County, Texas and located at 2185 E. Southlake Blvd., Southlake, Texas. Motion: McCaskill Second: Talley Ayes: Talley, Robbins, McCaskill, Huffman, Smith, Williamson Nays: None Absent: Torres-Lepp Approved TO DENY: 6-0 7B. ORDINANCE NO. 480-806, ZA23-0042, 1ST READING, ZONING CHANGE AND SITE PLAN FOR FLOOR AND DÉCOR, FOR PROPERTY DESCRIBED AS TRACT 1B02, JOHN A FREEMAN SURVEY ABSTRACT NO. 529, CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS AND LOCATED AT 2185 E. SOUTHLAKE BLVD., SOUTHLAKE, TEXAS. CURRENT ZONING: “B-1” BUSINESS SERVICE PARK DISTRICT. REQUESTED ZONING: “S-P-1” DETAILED SITE PLAN DISTRICT. SPIN NEIGHBORHOOD #8. DENIED REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 10 of 11 Director of Planning and Development Services Dennis Killough presented Item 7A and answered questions from Council. Motion was made to DENY Item 7B, Ordinance No. 480-806, ZA23-0042, 1st Reading, Zoning Change and Site Plan for Floor and Décor, for property described as Tract 1B02, John A Freeman Survey Abstract No. 529, City of Southlake, Tarrant County, Texas and located at 2185 E. Southlake Blvd., Southlake, Texas. Motion: McCaskill Second: Talley Ayes: Talley, Robbins, McCaskill, Huffman, Smith, Williamson Nays: None Absent: Torres-Lepp Approved TO DENY: 6-0 8. RESOLUTIONS: (THERE ARE NO ITEMS ON THIS AGENDA.) 9. OTHER ITEMS FOR CONSIDERATION: 9A. CITY COUNCIL CONFIRMATION OF THE CITY MANAGER’S APPOINTMENT OF PILAR SCHANK AS THE DIRECTOR OF COMMUNICATIONS. APPROVED Senior Director of Human Resources Stacey Black presented Item 9A and answered questions from Council. Motion was made to approve Item 9A, City Council confirmation of the City Manager’s appointment of Pilar Schank as the Director of Communications. Motion: McCaskill Second: Talley Ayes: Talley, Robbins, McCaskill, Huffman, Smith, Williamson Nays: None Absent: Torres-Lepp Approved: 6-0 10. OTHER ITEMS FOR DISCUSSION: (THERE ARE NO ITEMS ON THIS AGENDA.) 11. ADJOURNMENT Mayor Huffman adjourned the meeting at 9:04pm. *An audio recording of this meeting will be permanently retained in the City Secretary’s Office. REGULAR CITY COUNCIL MEETING MINUTES, SEPTEMBER 19, 2023 Page 11 of 11 MINUTES APPROVED ON THIS, THE 3RD OF OCTOBER 2023. ______________________________ John Huffman Mayor ATTEST: ______________________________ Amy Shelley, TRMC City Secretary M E M O R A N D U M October 3, 2023 To: Shana Yelverton, City Manager From: Daniel Cortez, Director of Economic Development & Tourism Subject: Item 4B - Resolution No. 23-023, reauthorizing the framework, role, responsibilities, and providing appointment of the Target Industry Recruitment Task Force with oversight from the Community Enhancement and Development Corporation. Action Requested: Approve Resolution No. 23-023, reauthorizing the framework, role, and responsibilities, and providing appointment of the Target Industry Recruitment Task Force with oversight from the Community Enhancement and Development Corporation. Background Information: The City Council's adoption of the Southlake 2035: Economic Development Master Plan Addendum, in March of 2021, established strategic goals for the Economic Development & Tourism Department. One of these strategic goals was to achieve economic prosperity through tax and employment base growth, attracting investment of private capital into our economy that grows jobs, creates opportunity, and increases tax revenue. Recommendation EDA1, within the plan, directs the City to utilize relevant economic health data to evaluate Southlake’s commercial centers and work with property owners to identify challenges and potential solutions to filling vacant spaces in the post-pandemic economic environment. To help achieve this effort, the City must also dedicate its time to attracting an increased daytime population by recruiting new businesses that bring shoppers and diners to the community. In 2021, the City Council requested that City staff work with the Community Enhancement and Development Corporation (CEDC) to develop the framework, role, and responsibilities for a Target Industry Recruitment Task Force. To this end, in September of 2021, Resolution 21-029 was adopted by the City Council which established the framework and appointment for the task force. Since its formation, the task force has worked with staff to discuss and engage with potential target industry businesses and corporate prospects looking to relocate and assisted the City in achieving its economic goals such as reevaluating its target industries and providing direction on its workforce attainment program. With this reauthorization, the Task Force will be developing, with City staff, a formal Business Recruitment Program geared towards attracting key businesses within the City’s identified target industries, identifying and evaluating business prospects for relocation, advise City staff on targeted marketing toward recruitment efforts, and providing leads on prospective businesses. These efforts will be conducted in coordination with the Community Enhancement and Development Corporation. Strategic Link: This item specifically addresses the City’s management of its business by (B3) maintaining an environment of future readiness by understanding and acting upon the forces, trends, and coming challenges affecting services. Financial Considerations: There are no financial considerations associated with the reauthorization of this Task Force. Alternatives: The City Council may consider any of the following alternatives if not approving this resolution as presented: A. Modify the reauthorization of the framework, role, and responsibilities of the Target Industry Recruitment Task Force under Resolution 23-023. B. Deny the reauthorization of the framework, role, and responsibilities of the Target Industry Recruitment Task Force under Resolution 23-023. Attachments: Resolution 23-023: Reauthorization of the Target Industry Recruitment Task Force and its framework, role, responsibilities, and appointment of members Staff Contacts: Daniel Cortez (817) 748-8039 RESOLUTION NO. 23-023 A RESOLUTION OF THE CITY OF SOUTHLAKE, TEXAS THE CITY COUNCIL IS REAUTHORIZING THE FRAMEWORK FOR THE TARGET INDUSTRY RECRUITMENT TASK FORCE, DEFINING THE ROLE AND RESPONSIBILITIES OF SUCH TASK FORCE, AND PROVIDING THE APPOINTMENT FOR REPRESENTATIVES TO SERVE ON THE TASK FORCE. WHEREAS, the City of Southlake, Texas (“City”) wishes to continue to optimize the City’s commercial tax base by attracting high-quality new businesses to reduce the tax burden on residential taxpayers; and WHEREAS, the reauthorization of a Target Industry Recruitment Task Force would assist with the attraction of target industries resulting in the retaining of high-quality jobs, developing vibrant communities, and improving the quality of life in the community; and WHEREAS, the City Council is reauthorizing the framework, role, and responsibilities of the Target Industry Recruitment Task Force with oversight of the Community Enhancement and Development Corporation; and WHEREAS, the City Council will appoint members to this Target Industry Recruitment Task Force similarly as it appoints members of the public to various boards, commissions , and committees; and NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS: SECTION 1. All the findings in the preamble are found to be true and correct and the City Council does hereby incorporate said findings into the body of this resolution as if copied in its entirety. SECTION 2. The Mission of the Target Industry Recruitment Task Force shall be to facilitate and assist in the recruitment and attraction of target industry prospects to the City of Southlake, demonstrating the City’s value, premier location, skilled workforce & talent, world-class businesses, high-quality of life, and thoughtfully planned community. SECTION 3. The Target Industry Recruitment Task Force shall work under these operating guidelines: Goal 1: Grow Southlake’s Target Industry economic base. • Collaborate with City staff to meet with target industry business prospects. Goal 2: Support corporate recruitment to the community • Identify target industry business prospects and recruitment opportunities that would benefit Southlake. Goal 3: Foster collaboration between target industries and the community. • Serve as ambassadors to business prospects or businesses that have relocated by providing community resources and local contacts. Goal 4: Elevate the Southlake brand and value proposition. • Work with and advise City staff and the CEDC on target industry communication and recruitment marketing efforts. Goal 5: Advise community leaders on business recruitment efforts. • Evaluate business prospects compatibility based on adopted economic development goals. SECTION 4. The Target Industry Recruitment Task Force appointments shall be made under the following terms: 1) All appointments to the Target Industry Recruitment Task Force shall be made by the City Council. 2) The Task Force terms are 2 years unless reappointed by the City Council or the task force member resigns. 3) The Task Force members shall be residents or business representatives of the community. 4) The Task Force will be made up of no less than 7 appointed members. 5) The Task Force will be made up of 50% Southlake residents. 6) The Task Force will sunset in two years unless reauthorized by the City Council. SECTION 5. The following representatives are appointed to serve as task force members under the framework provided in this resolution and until their successors have been duly appointed and qualified by the City Council. Target Industry Recruitment Task Force Appointees: PASSED, APPROVED, AND ADOPTED THIS 3RD DAY OF OCTOBER 2023. ___________________________________ John Huffman, Mayor ATTEST: APPROVED AS TO FORM: __________________________________ ___________________________________ Amy Shelley, TRMC City Attorney Item 4C Page 1 of 2 M E M O R A N D U M (October 3, 2023) To: Shana Yelverton, City Manager From: Rob Cohen, Director of Public Works Subject: Approve an Encroachment and Joint Use Agreement for a driveway bridge crossing within the drainage easement being located at 2905 Harbor Refuge. Action Requested: Approve an Encroachment and Joint Use Agreement for a driveway bridge crossing within the drainage easement being located at 2905 Harbor Refuge. Background Information: The Developer of 2905 Harbor Refuge is requesting to construct a driveway bridge crossing within a drainage easement located along the rear of the property. The purpose of this item is to seek City Council approval of an Encroachment and Joint Use Agreement for the installation of a 3’ tall bridge crossing the existing creek, consisting of 3 - 42-inch culverts with a retaining wall on either side, within the drainage easement at 2905 Harbor Refuge. This agreement will allow the developer to place the bridge crossing to provide vehicular access to the proposed detached garage. The property owner will be responsible for all necessary maintenance on the bridge crossing, including the 3 – 42-inch culverts, retaining walls, traffic rails, and pavement. The encroachment agreement outlines the maintenance responsibilities. Currently the property owner is working to obtain an earth disturbance permit to begin grading and excavation. A building permit for the property has not been applied for yet, however, to be proactive in the process the property owner is looking to obtain approval of their encroachment agreement now to not hold up the future building permit processes. Staff is requesting City Council to consider the proposed drainage easement encroachment for the proposed improvements to the development at 2905 Harbor Refuge. Financial Considerations: This is a no cost agreement. Item 4C Page 2 of 2 Strategic Link: This item links to the City’s Strategy Map strategic focus areas are Partnership & Volunteerism. It specifically relates to the Critical Business Outcome is, B2: Collaborating with select partners to implement service solutions. Citizen Input/ Board Review: None. Legal Review: The City Attorney has reviewed and approved the agreement. Alternatives: The City Council may approve or deny the agreement. Supporting Documents: Attachment A: Encroachment Agreement Documents Attachment B: Location Map Staff Recommendation: Approve an Encroachment and Joint Use Agreement for a driveway bridge crossing within the drainage easement being located at 2905 Harbor Refuge. Staff Contact: Rob Cohen, Director of Public Works Sandy Endy, P.E., CFM, Development Engineer Kevin Ferrer, P.E.,CFM, City Engineer Location Map Burney Lane Proposed Development Harbor RefugeN. Carroll Ave. City of Southlake September 19, 2023 Craig Jacobson RGA Architects Re: 2905 Harbor Refuge Encroachment Agreement Dear Mr. Jacobson, In response to your request, the City of Southlake Public Works Department has reviewed the drainage easement encroachment agreement for the placement of driveway bridge crossing over the existing creek. This letter is intended to represent the City’s approval for the proposed driveway bridge encroachment into the drainage easement with the following requirements: the property owner shall be responsible for the maintenance of the bridge crossing, including the proposed 3-42” RCP, retaining walls, traffic rails, and paving. If you have any questions or require additional information, please contact Sandy Endy at (817) 748-8033 or sendy@ci.southlake.tx.us Sincerely, Sandy Endy, PE Development Engineer NO. 2AEXHIBIT 111 Hillside Drive Lewisville, Texas 75057 972. 436. 9712 201 Country View Drive Roanoke, Texas 76262 940. 240. 1012 TBPE: 19762 TBPLS: 10194440 www.mcadamsco.com The John R. McAdams Company, Inc.“” ’ ’ “” ’ ’ ’ EXHIBIT NO. 3 The undersigned public utility companies, using or entitled to use, under the terms and provisions of our respective franchise with the City of Southlake, do hereby consent to the encroachment and joint use of the described portion of such drainage and / or utility easement requested in this Application for encroachment and joint use of a public drainage and utility easement. Oncor Electric Delivery Company AT&T / Southwestern Bell Telephone Company By: ____________________________ By: ______________________________ (Please Print) (Please Print) Title: ___________________________ Title: _____________________________ (Please Print) (Please Print) Signature: ________________________ Signature: __________________________ Verizon Telephone Company Tri-County Electric Company By: ____________________________ By: ______________________________ (Please Print) (Please Print) Title: ___________________________ Title: _____________________________ (Please Print) (Please Print) Signature: ________________________ Signature: __________________________ Charter Communications, Inc. City of Southlake By: ____________________________ By: ______________________________ (Please Print) (Please Print) Title: ___________________________ Title: _____________________________ (Please Print) (Please Print) Signature: ________________________ Signature: __________________________ Atmos Energy By: ____________________________ (Please Print) Title: ___________________________ (Please Print) Signature: ________________________ M E M O R A N D U M October 3, 2023 To: Mayor and City Council From: James Brandon, Chief of Police Subject: Repealing Article VII, Curfew For Minors Action Requested: Ordinance No. 928A, 1st Reading, an ordinance of the City Council of the City of Southlake, Texas, repealing article VII, "Curfew For Minors" of Chapter 15, "Public Safety" of the Southlake City Code. Background Information: The purpose of this request is to repeal article VII, "Curfew For Minors" of Chapter 15 "Public Safety" of the Southlake City Code; providing a severability clause; and providing an effective date in accordance with State law. Strategic Link: C1 - Achieve the highest standards of safety & security. Legal Review: The proposed item was reviewed by the City Attorney’s Office. Supporting Documents: Ordinance No. 928A Staff Recommendation: Staff recommends approval of Ordinance No. 928A as proposed. Item 4D ORDINANCE NO. ___ 928A_____ AN ORDINANCE OF THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS, REPEALING ARTICLE VII, “CURFEW FOR MINORS” OF CHAPTER 15, “PUBLIC SAFETY” OF THE SOUTHLAKE CITY CODE; PROVIDING A SEVERABILITY CLAUSE; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City of Southlake, Texas (“City”) is a home rule city acting under its charter adopted by the electorate pursuant to Article XI, Section 5 of the Texas Constitution and Chapter 9 of the Local Government Code; and WHEREAS, the City Council of the City of Southlake adopted a curfew ordinance for minors in the City which is codified as “Article VII, “Curfew for Minors” of Chapter 15, “Public Safety” of the Southlake City Code; and WHEREAS the City Council has determined that, based on the passage of House Bill 1819, “Juvenile Curfew,” which bans the imposition of a curfew of persons younger than 18 years of age, except for purposes of emergency management, signed into law June 9, 2023, there exists a need to repeal “Article VII, “Curfew for Minors” of Chapter 15, “Public Safety” of the Southlake City Code. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL, CITY OF SOUTHLAKE, TEXAS, THAT: SECTION 1. Article VII, “Curfew for Minors” of Chapter 15, “Public Safety” of the Southlake City Code is hereby repealed in its entirety. SECTION 2. It is hereby declared to be the intention of the City Council that the phrases, clauses, sentences, paragraphs, and sections of this Ordinance are severable, and if any phrase, clause, sentence, paragraph or section of this Ordinance shall be declared unconstitutional by the valid judgment or decree of any court of competent jurisdiction, such unconstitutionality shall not affect any of the remaining phrases, clauses, sentences, paragraphs and sections of this Ordinance, since the same would have been enacted by the City Council without the incorporation in this Ordinance of any such unconstitutional phrase, clause, sentence, paragraph or section. SECTION 3. This Ordinance shall be in full force and effect from and after the date of its passage. PASSED AND APPROVED on this the ____ day of _______ 2023. Item 4D Item 4D ______________________________ JOHN HUFFMAN, MAYOR CITY OF SOUTHLAKE, TEXAS ATTEST: ______________________________ AMY SHELLEY, CITY SECRETARY CITY OF SOUTHLAKE, TEXAS APPROVED AS TO FORM AND LEGALITY: __________________________________ E. ALLEN TAYLOR, CITY ATTORNEY Case No. CP23-0001 S T A F F R E P O R T September 26, 2023 CASE NO: CP23-0001 PROJECT: Land Use Plan Amendment for 2185 E. Southlake Blvd. (proposed Floor and Décor) EXECUTIVE SUMMARY: Philip Cochran of Floor and Décor and Bill Dahlstrom of Jackson Walker LLP, on behalf of the owner Greenway – 1709 Eleven Partners, are requesting approval of a Land Use Plan amendment for Floor and Décor, for property described as Tract 1B02, John A Freeman Survey Abstract No. 529, City of Southlake, Tarrant County, Texas and located at 2185 E. Southlake Blvd., Southlake, Texas. Current Land Use Designation: Retail Commercial and Office Commercial. Requested Land Use Designation: Retail Commercial and Office Commercial with a Site- Specific Recommendation. Current Zoning: “B-1” Business Service Park District. Requested Zoning (ZA23-0042): “S-P-1” Detailed Site Plan District. SPIN Neighborhood #8. Specifically, the request is to modify the Future Land Use Map to identify the property at 2185 E. Southlake Blvd. as an area that has a site-specific recommendation in the Consolidated Land Use Plan. The site-specific recommendation, designated as 114-LU18, will be added to the “Summary of Land Use Changes” table in the Consolidated Land Use Plan. The proposed site- specific recommendation is as follows: “Allow S-P-1 (Detailed) Site Plan zoning to allow for a large single-tenant retail development (approximately 75,000 square feet).” DETAILS: The purpose of this request is to propose a Land Use Plan amendment for the purpose of zoning and developing the property for an approximately 75,000 square foot building intended for retail uses – specifically a Floor and Décor retail center. A Zoning Change and Site Plan application for Floor and Décor has been submitted under case ZA23-0042. The property is a 7.8-acre tract of land located southwest of the intersection of East Southlake Boulevard and South Kimball Avenue. The site is currently unimproved and is split between two land use designations - Retail Commercial on the northern portion of the site and Office Commercial on the southern portion of the site. The City Council denied this request on the 1st reading held on September 19, 2023. A public hearing was advertised for the October 3, 2023, City Council meeting. The applicant has requested that this item be withdrawn from consideration. Department of Planning & Development Services Department of Planning & Development Services Case No. CP23-0001 Existing Land Use Designations Retail Commercial Purpose and Definition: The Retail Commercial category is a lower- to medium-intensity commercial category providing for neighborhood-type retail shopping facilities and general commercial support activities. It is intended to provide limited local retail and/or office uses which serve neighborhoods in close proximity. It is intended that all uses in this category will be compatible with adjacent single family uses, thereby maintaining the character and integrity of existing neighborhoods. This category is intended to encourage comprehensively planned developments. In areas where the Retail Commercial designation is adjacent to residentially zoned properties or areas with a residential designation on the Land Use Plan, lower intensity activities such as office or office-related uses should be planned adjacent to the residential uses. Other suitable activities are those permitted in the Public Parks/Open Space, Public/Semi-Public, and Office Commercial categories previously discussed. Land Use Mix*: The percentages below for the land use mix in the Retail Commercial category are intended only to be guidelines, and greater flexibility may be appropriate under site specific conditions. Land Use Percentage of Acreage Flexibility Allowed Retail 65% +35% Office 20% ±20% Open space 10% ±10% Civic use 5% ±5% Total 100% *These percentages are not regulatory and should only be used as a guide. Case No. CP23-0001 Office Commercial Purpose and Definition: The Office Commercial category is a commercial category designed and intended for the exclusive use of office and limited office‐related activities. It is established for and will be allocated to those districts best suited for supporting commercial activity of an office character. It has been established to encourage and permit general professional and business offices of high quality and appearance, in attractive landscaped surroundings with the types of uses and design exterior appearance so controlled as to be generally compatible with existing and future adjacent and surrounding residential development. Properties with this designation may serve as a transition between established residential neighborhoods, major roadways, and retail development. Other suitable activities are those permitted in the Public Parks/Open Space and Public/Semi‐Public categories previously discussed. Land Use Mix*: The percentages below for the land use mix in the Office Commercial category are intended only to be guidelines, and greater flexibility may be appropriate under site specific conditions. Land Use Percentage of Acreage Flexibility Allowed Office 85% ±15% Open space 10% ±10% Civic use 5% ±5% Total 100% *These percentages are not regulatory and should only be used as a guide. Proposed Land Use Amendment The proposal is to retain the existing underlying land use designations and add the following to the “Summary of Land Use Changes” table, for the S.H. 114 Corridor of the Consolidated Future Land Use Plan: Enlarged Recommendations/Policy: Case No. CP23-0001 ACTION NEEDED: 1) Consider 2nd Reading of the Land Use Plan Amendment 2) Conduct a Public Hearing ATTACHMENTS: (A) Background Information (B) Applicant’s Narrative (C) Ordinance No. 1269A Land Use Statement STAFF CONTACT: Jenny Crosby (817) 748-8195 Dennis Killough (817) 748-8072 Case No. Attachment A CP23-0001 Page 1 BACKGROUND INFORMATION OWNER: Greenway – 1709 Eleven Partners APPLICANT: Philip Cochran – Floor and Décor Bill Dahlstrom – Jackson Walker, LLP PROPERTY SITUATION: 2185 E. Southlake Blvd. LEGAL DESCRIPTION: Tract 1B02, John A Freeman Survey Abstract No. 529 LAND USE CATEGORY: Retail Commercial, Office Commercial PROPOSED LAND USE CATEGORY: Retain existing underlying land uses and add a site-specific recommendation. CURRENT ZONING: “B-1” Business Service Park District PROPOSED ZONING: “S-P-1” Detailed Site Plan District HISTORY: - The property was annexed into the City in 1957. - The zoning designation of “B-1” Business Service Park District was placed on the property with the adoption of Ordinance No. 480 in 1989. PLANNING AND ZONING COMMISSION: September 7, 2023; DENIED (6-0). CITY COUNCIL: September 19, 2023; 1st Reading DENIED (6-0). Case No. Attachment B CP23-0001 Page 1 Applicant’s Narrative: Case No. Attachment B CP23-0001 Page 2 Case No. Attachment B CP23-0001 Page 3 Case No. Attachment B CP23-0001 Page 4 Case No. Attachment C CP23-0001 Page 1 ORDINANCE NO. 1269A AN ORDINANCE AMENDING THE CONSOLIDATED FUTURE LAND USE PLAN, AN ELEMENT OF THE CITY OF SOUTHLAKE’S COMPREHENSIVE PLAN. WHEREAS, a Home Rule Charter of the City of Southlake, Texas, was approved by the voters in a duly called Charter election on April 4, 1987; and, WHEREAS, the Home Rule Charter, Chapter XI requires an update to the City’s comprehensive plan elements every four years, WHEREAS, the City Council recognizes that the Consolidated Future Land Use Plan is an element of the City’s Comprehensive Master Plan, WHEREAS, the City Council has determined that the Consolidated Future Land Use Plan complies with the Southlake 2035 Vision, Goals, & Objectives, WHEREAS, the City Council has deemed that the Consolidated Future Land Use Plan has been formulated with adequate public input, WHEREAS, the City Council has deemed that the recommendations in the Consolidated Future Land Use Plan herein reflect the community’s desires for the future development of the City, NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS, THAT: Section 1. All of the findings in the preamble are found to be true and correct and the City Council hereby incorporates said findings into the body of this ordinance as if copied in its entirety. Section 2. (Adopted Change). Section 3. The different elements of the Comprehensive Master Plan, as adopted and amended by the City Council from time to time, shall be kept on file in the office of the City Secretary of the City of Southlake, along with a copy of the ordinance and minute order of the Council so adopting or approving the same. Any existing element of the Comprehensive Master Plan which has been heretofore adopted by the City Council shall remain in full force until amended by the City Council as provided herein. Section 4. This ordinance shall be cumulative of all provisions of ordinances of the City of Southlake, Texas, except where the provisions of this ordinance are in direct conflict with the provisions of such ordinances, in which event the conflicting provisions of such ordinances are hereby repealed. Case No. Attachment C CP23-0001 Page 2 Section 5. It is hereby declared to be the intention of the City Council that the phrases, clauses, sentences, paragraphs and sections of this ordinance are severable, and if any phrase, clause, sentence, paragraph or section of this ordinance shall be declared unconstitutional by the valid judgment or decree of any court of competent jurisdiction, such unconstitutionality shall not affect any of the remaining phrases, clauses, sentences, paragraphs and sections of this ordinance, since the same would have been enacted by the City Council without the incorporation in this ordinance of any such unconstitutional phrase, clause, sentence, paragraph or section. Section 6. The City Secretary of the City of Southlake is hereby authorized to publish this ordinance in book or pamphlet form for general distribution among the public, and the operative provisions of this ordinance as so published shall be admissible in evidence in all courts without further proof than the production thereof. Section 7. This ordinance shall be in full force and effect from and after its passage and publication as required by law, and it is so ordained. PASSED AND APPROVED on the 1st reading the _____ day of ______, 2023. __________________________ MAYOR ATTEST: __________________________ CITY SECRETARY PASSED AND APPROVED on the 2nd reading the _______ day of _______, 2023. _________________________ MAYOR ATTEST: __________________________ CITY SECRETARY APPROVED AS TO FORM AND LEGALITY: _________________________________ Case No. Attachment C CP23-0001 Page 3 CITY ATTORNEY DATE:___________________________ ADOPTED:_______________________ EFFECTIVE:______________________ LAND USE STATEMENT 2185 East Southlake Boulevard, Southlake, Texas 76092 (the “Property”) I. PURPOSE OF REQUEST The purpose of this request is to submit three (3) development applications for the Property: (1) Zoning Application; (2) Site Plan Application; and (3) Comprehensive Plan Amendment Application. The Zoning and Site Plan Applications are to request an S-P-1 (Detailed) Site Plan to govern the Property. The Comprehensive Plan Amendment Application is to request a site-specific recommendation for the Property. II. CURRENT LAND USE The Property is currently zoned as a “B-1 Business Service Park District” and is vacant, infill land. The City’s Comprehensive Plan has two (2) Future Land Use designations for the Property: (1) “Retail Commercial” on the northern portion of Property; and (2) “Office Commercial” on the southern portion of Property. III. PROPOSED LAND USE This application proposes a new S-P-1 (Detailed) Site Plan for the Property, which would allow for an approximately 75,000 square foot, single-tenant retail use. IV. SURROUNDING LAND USE North and east of the Property is zoned S-P-1 (Detailed) Site Plan, which includes various retail and restaurant uses, while south and west of the property is zoned Community Service, which includes church and school uses. Case No. ZA23-0042 S T A F F R E P O R T September 26, 2023 CASE NO: ZA23-0042 PROJECT: Zoning Change and Site Plan for Floor and Decor EXECUTIVE SUMMARY: Philip Cochran of Floor and Décor and Bill Dahlstrom of Jackson Walker LL P, on behalf of the owner Greenway – 1709 Eleven Partners, are requesting approval of a Zoning Change and Site Plan for Floor and Décor, for property described as Tract 1B02, John A Freeman Survey Abstract No. 529, City of Southlake, Tarrant County, Texas and located at 2185 E. Southlake Blvd., Southlake, Texas. Current Zoning: “B-1” Business Service Park District. Requested Zoning: “S -P-1” Detailed Site Plan District. SPIN Neighborhood #8. DETAILS: The property is an approximately 8-acre tract of land located southwest of the intersection of East Southlake Boulevard and South Kimball Avenue . The purpose of this request is to consider a Zoning Change and Site Plan approval for a roughly 7.8-acre lot of land from “B-1” Business Service Park District to “S-P- 1” Detailed Site Plan District zoning with “B-1” Business Service Park District and “C-3” General Commercial District uses, and including a single occupancy retail tenant that is greater than 60,000 square feet . The applicant is proposing an approximately 75,000 square foot building intended for retail uses, more specifically a Floor and Décor retail center. The building as proposed will be completely masonry in construction and 25’ in height except for a decorative entry feature above the main entrance on the north façade, topping at 37’ in height. The Development Regulations accommodate this height, however this would generally not be considered a variance and meets the Height Exceptions of Ordinance No. 480, as amended, Section 33.5. The applicant is proposing a reduction in parking supported by a Parking and Trip Generation analysis provided. The property will have two points of access for traffic circulation to a common access driveway with direct access to E. Southlake Blvd. and Village Center Drive. Case No. ZA23-0042 The City Council denied this request on the 1st reading held on September 19, 2023. A public hearing was advertised for the October 3, 2023, City Council meeting. The applicant has requested that this item be withdrawn from consideration. Please be aware that written opposition has been received from property owner(s) within 200 feet of the subject zoning change request which exceeds 20% of the surrounding 200 f oot area. This will require a Super Majority vote in favor by the City Council (6 of the 7 members) to approve. PROPOSED “S-P-1” REGULATIONS: Proposing a reduction in parking from the required number of 318 to 143. A Parking and Trip Generation Study has been provided by Kimley Horn. Requesting approval of “Regal Red” as an accent color as shown on the façade elevations. The color falls in the range of prohibited colors. Variance to Ordinance No. 480, as amended, Section 42.4(f) regarding bufferyard requirements. The applicant is proposing to plant less than the required bufferyard canopy trees within the north and west bufferyards, and less than the required accent trees within the west bufferyard. The difference across the entire development is fourteen (14) less canopy trees, and seventeen le ss accent trees. The applicant proposes to increase the caliper size of twenty-eight (28) canopy trees provided within the bufferyards to 6” to compensate for providing less than the required number of trees. REQUESTED VARIANCE: Variance to Driveway Ordinance No. 634, as amended, Section 5.2. Stacking depth between the edge of Village Center Drive and the proposed south driveway of Floor and Decor is required to be 100’. The applicant is proposing approximately 41.5’ in order to align with an existing driveway across the common access road. Case No. ZA23-0042 ACTION NEEDED: 1) Hold a Public Hearing 2) Consider 2ND Reading ATTACHME NTS: (A) Background Information (B) Vicinity Map (C) Plan Review Summary No. 3, dated September 1, 2023 (D) Surrounding Property Owners Map (E) Surrounding Property Owner Responses & Comment Cards (F) Ordinance No. 480-806 Full Size Plans (for Commission and Council members only) Proposed Development Regulations Corridor Planning Committee Report SPIN meeting Report PowerPoint Presentation Plans Parking and Trip Generation Study TIA STAFF CONTACT: Reagan Rothenberger (817) 748-8602 Dennis Killough (817) 748-8072 Case No. Attachment A ZA23-0042 Page 1 BACKGROUND INFORMATION OWNER: Greenway – 1709 Eleven Partners APPLICANT: Philip Cochran – Floor and Décor Bill Dahlstrom – Jackson Walker, LLP PROPERTY SIT UATION: 2185 E. Southlake Blvd. LEGAL DESCRIPTION: Tract 1B02, John A Freeman Survey Abstract No. 529 LAND USE CATEGORY: Retail Commercial, Office Commercial CURRENT ZONING: “B-1” Business Service Park District PROPOSED ZONING: “S-P-1” Detailed Site Plan District HISTORY: - The property was annexed into the City in 1957. - The zoning designation of “B-1” Business Service Park District was placed on the property with the adoption of Ordinance No. 480 in 1989. SOUTHLAKE COMPREHENSIVE PLAN: Consolidated Future Land Use Plan The 2035 future land use designations for the site are primarily “Retail- Commercial” and “Office Commercial”. The site is roughly split between the two uses with Retail Commercial on the north side and Office Commercial on the south side. The applicant has proposed changes to these recommendations in a separate item (CP-23-0001). Retail Commercial Purpose and Definition: The Retail Commercial category is a lower- to medium-intensity commercial category providing for neighborhood-type retail shopping facilities and general commercial support activities. It is intended to provide limited local retail and/or office uses which serve neighborhoods in close proximity. It is intended that all uses in this category will be compatible with adjacent single family uses, thereby maintaining the character and integrity of existing neighborhoods. This category is intended to encourage comprehensively planned developments. In areas where the Retail Commercial designation is adjacent to residentially zoned properties or areas with a residen tial designation on the Land Use Plan, low er intensity activities such as office or office-related uses should be planned adjacent to the residential uses. Other s uitable activities are those permitted in the Public Parks/Open Space, Public/Semi-Public, and Office Commercial categories previously discussed. Office Commercial Purpose and Definition: The Office Commercial category is a commercial category designed and intended for the exclusive use of office and limited office‐related activities. It is established for and will be allocated to those districts best su ited for supporting commercial activity of an office character. It has been established to encourage and permit general professional and business offices of high quality and appearance, in attractive landscaped surroundings with the types of uses Case No. Attachment A ZA23-0042 Page 2 and design exterior appearance so controlled as to be generally compatible with existing and future adjacent and surrounding residential development. Properties with this designation may serve as a transition between established residential neighborhoods, major roadways, and retail development. Other suitable activities are those permitted in the Public Parks/Open Space and Public/Semi ‐Public categories previously discussed. Mobility & Master Thoroughfare Plan Access to the site will be through a common access easement with direct access to both E. Southlake Boulevard and S. Village Center Drive. The Master Thoroughfare Plan show s Southlake Blvd. to be a six-lane divided arterial with 130’ to 140’ of right of way. Village Center Drive is proposed to be a two-lane undivided collector with 60’ of right of way at build-out. Pathways Master Plan & Sidewalk Plan The Master Pathways Plan shows a greater than 8’ multi-use trail along Village Center Drive. The applicant is proposing to escrow funds for the sidewalk along the future extension of Village Center Drive adjacent to the site. TRANSPORTATION ASSESSMENT: Mobility & Master Thoroughfare Plan Access to the site will be through a common access easement with direct access to both E. Southlake Boulevard and S. Village Center Drive. The Master Thoroughfare Plan shows Southlake Blvd. to be a six-lane divided arterial with 130’ to 140’ of right of way. Village Center Drive is proposed to be a two-lane undivided collector with 60’ of right of way at build-out. Area Road and Network Conditions The site proposes access via a Common Access E asement to E. Southlake Blvd. and S. Village Center D rive. No traffic data exists for Village Center Drive. For the purposes of this analysis, staff has included data for S. Kimball Ave. as this is the only accessible roadway intersection with Village Center Drive at this time. E. Southlake Blvd. (F.M. 1709) (between Kimball Ave. and Carroll Ave.) 24hr West Bound (22,000) East Bound (23,522) AM Peak (1,506) 11:45-12:45 AM Peak (2,327) 7:15 – 8:15 AM PM Peak (2,223) 4:30 – 5:30 PM Peak (1,547) 12:30 – 1:30 PM * Based on the 2018 City of Southlake Traffic Count Report S. Kimball Ave. (between E. Southlake Blvd. and Crooked Lane) 24hr North Bound (5,605) South Bound (5,039) AM Peak (505) 7:45 - 8:45 AM Peak (557) 3:15 – 4:15 PM PM Peak (580) 4:30 – 5:30 PM Peak (460) 3:15 – 4:15 PM * Based on the 2018 City of Southlake Traffic Count Report Case No. Attachment A ZA23-0042 Page 3 Traffic Impact: A Traffic Impact Analysis (TIA) conducted by Halff Associates and a Trip Generation and Parking Analysis provided by Kimley Horn was reviewed by Teague Nall and Perkins, Inc. (TNP) who have no reservations with the City’s acceptance of these studies. The TIA makes the following general recommendations in summary: The study provides that the new development will generate approximately 83 new weekday AM peak hour one-way vehicle trips and 125 new weekday PM peak hour one-way vehicle trips. This study considered nine (9) Floor and Décor locations throughout the country. There has been significant interest in the increase in delivery traffic at this site. The TIA makes the following statement regarding such traffic: “Halff collected three (3) days of traffic counts at the access connections to the loading dock area on the south side of the Marshalls / PGA Superstore building, to identify current heavy veh icle activity in this area. A total of 108 heavy vehicle trips were observed across the three days that traffic count data was collected, an average of 36 heavy vehicle trips per day. Since each trip represents a one-way movement, either in to or out of the development, this equates to 18 heavy vehicles entering and exiting the Kimball Oaks site each day. Of the 108 total daily trips, 14 were observed entering the Dawson MS site from Village Center Drive. The count data also showed that heavy vehicle activi ty during the school AM and PM peak periods is minimal. An average of 2 heavy vehicle trips during the AM peak period and 5 heavy vehicle trips during the school PM peak period were observed across the three -day count duration. One of the AM peak period trips was associated with the school. It is important to note that the trips observed at the Kimball Avenue / Kimball Oaks driveway intersection cannot all be assumed to be associated with the Marshalls / PGA Superstore building, as there are seven other retail buildings within the Kimball Oaks that could be served by some of the truck traffic entering / exiting the site at this location.” No improvements to surrounding roadways are proposed at this time. The applicant’s Site Plan shows the dedication of Village Center Drive along the southern boundary of their site which would be provided with subdivision approval. Case No. Attachment A ZA23-0042 Page 4 TREE PRESERVATION: If the development were proposed as traditional zoning it would not comply with the Existing Tree Cover Preservation Requirements of the Tree Preservation Ordinance. There is 39.64% of existing tree cover on the site and a minimum of 60% would be required to be preserved. A total of 95.66% is proposed to be removed, and 4.34% is proposed to be preserved. The applicant is proposing to plant less than the required bufferyard canopy trees within the north and south bufferyards, and less than the required accent trees within the west bufferyard. The difference across the entire development is fourteen (14) less canopy trees, and seventeen le ss accent trees. The applicant proposes to increase the caliper size of twenty- eight (28) canopy trees provided within the bufferyards to 6” to compensate for providing less than the required number of trees. For property sought to be zoned for the Downtown zoning district or a planned development zoning district, including an S-P-1 Site Plan, S-P-2 Site Plan, Transition, Rural Conservation, Planned Unit Development, or Employment Center zoning district, the City Council shall consider the application for a Conservation Analysis or Plan in conjunction with the corresponding development application (as established in Table 1.0). The Planning and Zoning Commission shall review the application and make a recommendation to the City Council regarding the application. The City Council shall approve the Plan or Analysis if the Co uncil finds that the Plan or Analysis provides for the: i. placement of building pads, parking areas, driveways, streets, and utility easements so as to maximize the preservation of environmental features of the property including mature tree stands, natural creeks and ponds, and significant grades; ii. maximizes the preservation of tree cover preservation areas indicated on the Environmental Resource Protection Map; iii. maximizes the preservation of existing tree stands with the potential to buffer res idential areas from the noise, glare, and visual effects of nonresidential uses; iv. maximizes the preservation of existing trees, if any, adjoining a natural or man-made drainage creek; v. maximizes the preservation of existing protected trees along rural roadways and other streets as identified and prioritized in the Street Typology designation; and vi. mitigation of altered trees through proposed tree replacement procedures pursuant to this Ordinance. UTILITIES: An 8” water line exists along the east and west boundary of the property. An 8” sewer line exists along the west boundary of the property. Case No. Attachment A ZA23-0042 Page 5 DRAINAGE: Drainage on the property is to be channeled to existing storm drainage facilities. CITIZEN INPUT: A Corridor Planning Committee meeting for this project was held on March 29, 2023, and a SPIN Meeting for this item was held on April 25, 2023. P&Z COMMISSION ACTION: September 7, 2023; DENIED (6-0). CITY COUNCIL ACTION: September 19, 2023, 1st Reading; DENIED (6-0) STAFF COMMENTS: Attached is Site Plan Review Summary No. 3, dated September 1, 2023. Case No. Attachment B ZA23-0042 Page 1 Case No. Attachment C ZA23-0042 Page 1 SITE PLAN REVIEW SUMMARY Case No.: ZA23-0042 Review No.: Three Date of Review: 09/01/23 Project Name: Zoning Change and Site Plan – Floor & Decor APPLICANT: OWNER: Floor & Décor – Philip Cochran Greenway-1709 Eleven Partners 2500 Windy Ridge Pkwy SE Marietta, GA 30067 2800 Fairmount Street, STE 100 Dallas, TX 75201 C/O William Dahlstrom and Victoria Morris C/O Christy Hammons Phone: 214.953.5932 Phone: 214.699.4844 Email: wdahlstrom@jw.com / vmorris@jw.com Email: chammons@greenwayinvestment.com CITY STAFF HAS REVIEWED THE ABOVE REFERENCED PROJECT RECEIVED BY THE CITY ON 08/21/23 AND WE OFFER THE FOLLO WING STIPULATIONS. THESE STIPULATIONS ARE HEREBY MADE CONDITIONS OF SITE PLAN APPROVAL UNLESS SPECIFICALLY AMENDED BY THE CITY COUNCIL. IF YOU HAVE ANY QUESTIONS OR NEED FURTHER CLARIFICATION, PLEASE CONTACT REAGAN ROTHENBERGER AT (817) 748-8602. 1. No further comments. The following comments are informational. • All driveways must comply with the Driveway Ordinance No. 634, as amended. The following changes are needed: a. Sufficient stacking depth between the south driveway and Village Center Drive shall be provided. Staff calculates a required stacking depth of 100’ from the edge of the right of way line to the edge of the intersecting driveway. Development Standards note this standard. • An 8’ trail is required along the north side of Village Center Drive per the Pathways Master Plan. Development Standards note the applicant’s willingness to escrow funds for their portion of construction. • “Regal Red” as provided (RAL 3020) closely matches prohibited reds as described in Ord. 480, as amended, Section 33.21 and related appendices. Development Standards note that no more than 5% of the façade shall be this color. • Parking requirements are noted in the Development Standards. The minimum number of parking spaces called for in the development regulations for this specific tenant and specific use is 70, however, the Detailed Site Plan calls for 143. If the site were parked by code, it would require 318 parking spaces. A Parking Analys is has been provided by the applicant to justify the variance. Case No. Attachment C ZA23-0042 Page 2 Tree Conservation/Landscape Review TREE CONSERVATION COMMENTS: 1. If the development were proposed as traditional zoning it would not comply with the Existing Tree Cover Preservation Requirements of the Tree Preservation Ordinance. There is 39.64% of existing tree cover on the site and a minimum of 60% would be required to be preserved. A total of 95.66% is proposed to be removed, and 4.34% is proposed to be preserved. * Except as provided by subsection 7.2.b. of the Tree Preservation Ordinance, a Tree Conservation Analysis or Tree Conservation Plan shall be approved if it will preserve existing tree cover in accordance with the percentage requirements established by Table 2.0. If the property has previously received a tree permit related to development, the percentage of existing tree cover at the time the first such permit was issued shall be used to calculate the minimum existing tree cover that must be preserved under this section. Table 2.0 – Existing Tree Cover Preservation Requirements Percentage of existing tree cover on the entire site Minimum percentage of the existing tree cover to be preserved* 0% – 20% 70% 20.1 – 40% 60% 40.1% - 60% 50% 60.1% - 80% 40% 80.1% - 100% 30% *The minimum percentage of existing tree cover to be preserved shall exclude any area in public rights-of-way as approved by City Council. For property sought to be zoned for the Downtown zoning district or a planned development zoning district, including an S-P-1 Site Plan, S-P-2 Site Plan, Transition, Rural Conservation, Planned Unit Development, or Employment Center zoning district, the City Council shall consider the application for a Conservation Analysis or Plan in conjunction with the corresponding development application (as established in Table 1.0). The Planning and Zoning Commission shall review the application and make a recommendation to the City Council regarding the application. The City Council shall approve the Plan or Analysis if the Council finds that the Plan or Analysis provides for the: i. placement of building pads, parking areas, driveways, streets, and utility easements so as to maximize the preservation of environmental features of the property including mature tree stands, natural creeks and ponds, and significant grades; ii. maximizes the preservation of tree cover preservation areas indicated on the Environmental Resource Protection Map; iii. maximizes the preservation of existing tree stands with the potential to buffer residential areas from the noise, glare, and visual effects of nonresidential uses; iv. maximizes the preservation of existing trees, if any, adjoining a natural or man-made drainage creek; Case No. Attachment C ZA23-0042 Page 3 v. maximizes the preservation of existing protected trees along rural roadways and other streets as identified and prioritized in the Street Typology designation; and vi. mitigation of altered trees through proposed tree replacement procedures pursuant to this Ordinance. * Please be aware that all existing trees shown to be preserved on the City Council approved Tree Conservation Plan must be preserved and protected during all phases and construction of the development. Alteration or removal of any of the existing trees shown to be preserved on the approved Tree Conservation Plan is a violation of the Tree Preservation Ordinance and the zoning as approved by the Southlake City Council. Please ensure that the layout of all structures, easements, utilities, structures grading, and any other structure proposed to be constructed do not conflict with existing trees intended to be preserved. LANDSCAPE COMMENTS: 1. Please provide a variance request to the Bufferyads Regulations of Section 42, within the City of Southlake Zoning Ordinance for proposing to not plant the full amount of required canopy trees and accent trees within the bufferyards. This is included in the Development Regulations. The applicant is proposing to plant less than the required bufferyard canopy trees within the north and south bufferyards, and less than the required accent trees within the west bufferyard. The difference across the entire development is fourteen (14) less canopy trees, and seventeen less accent trees. The applicant proposes to increase the caliper size of twenty-eight (28) canopy trees provided within the bufferyards to 6” to compensate for providing less than the required amount. * Three (3) existing trees are proposed to be preserved and credited towards required interior landscape canopy trees. Existing tree credits shall only be granted if the tree/s are in healthy condition and all requirements of the Tree Preservation Ordinance have been met as determined at the time of inspection for a Permanent Certificate of Occupancy. * Indicates informational comment. # Indicates required items comment. Case No. Attachment C ZA23-0042 Page 4 Public Works/Engineering Review 1. I-values for both pre and post do not match the most current values from the ISWM manual. 2. The total drainage area for both pre and post do not match. * Rather than extending a stub to the west for a future water along Village Center Drive and constructing a parallel public water line along the southern side of the proposed building, Public Works woul d rather extend the proposed 8” waterline along Village Center to the west and connect the looped li ne. This will eliminate the para llel public water lines and just push the southern waterline within right-of-way. Sandra Endy, P.E. Development Engineer Phone: (817) 748-8033 E-mail: sendy@ci.southlake.tx.us Case No. Attachment C ZA23-0042 Page 5 Fire Department Review 1. The required backflow protection (double check valve) for the sprinkler system can be located on the riser if the riser is within 100 feet of the water main, measured linearly along the length of the pipe. If the riser is further than 100 feet from the main, the doub le check valve shall be in a vault. Riser rooms shall be a minimum of 5’X5’ if the double check is located in a vault, or a minimum of 6’X6’ if it is located on the riser. (Label riser location to verify exact termination point of piping, and indicate size of the riser room, if the room is enclosed within the warehouse) (If not enclosed in a room, show protection barriers around the fire protection equipment to prevent damage or obstruction to the components of the system) 2. The Fire Department Connection for the sprinkler system must be within 100 feet of a fire hydrant, and within 50 feet of fire department fire lanes on the property. (FDC location not indicated on the plans) Add FDC location, wall mount or remote connection to meet the distance requirements. Kelly Clements Deputy Fire Chief/Fire Marshal Phone: (817) 748-8233 E-mail: kclements@ci.southlake.tx.us Case No. Attachment C ZA23-0042 Page 6 General Informational Comments * The Development Review Committee (DRC) has determined that this pre-submittal is sufficient for formal consideration by the Planning and Zoning Com mission (P&Z). A formal submittal must be received at the City by 5:00 P.M. on August 21, 2023 in order to move forward to the September 7th Planning and Zoning Commission meeting. * No review of proposed signs is intended with this site plan. A separate building permit is required prior to construction of any signs. * All mechanical equipment must be screened of view from right-of-ways and residential properties in accordance with the Zoning Ordinance No. 480, as amended. * Noise levels shall comply with the requirements of the current noise ordinance, as amended. * All lighting must comply with the Lighting Ordinance No. 693, as amended. * All development must comply with the Drainage Ordinance No. 605 and the Erosion and Sediment Control Ordinance No. 946, as amended. * It appears that this property lies within the 75 LDN D/FW Regional Airport Overlay Zone and will require construction standards that meet requirements of the Airport Compatible Land Use Zoning Ordinance No. 479. * Development must comply with all requirements in Zoning Ordinance No. 480, Section 43, Overlay Zones. * The applicant should be aware that prior to issuance of a building permit a plat must be processed, a fully corrected site plan, landscape plan, irrigation plan, and building plans, must be submitted for approval and all required fees must be paid. This may include but not be limited to the following fees: Park Fee, Perimeter Street Fee, Water & Sewer Impact and Tap F ees, and related Permit Fees. * In addition to the City of Southlake impact fees, please be aware that through the wholesale water customer contract with the City of Fort Worth, all new water connections are required to pay the City of Fort Worth impact fee. The City of Fort Worth impact fee assessment is based on the final plat recordation date and building permit issuance. The applicant is encouraged to review the City of Fort Worth's assessment and collection of Impact Fees Guide to determine the fee amount. * Denotes Informational Comment Case No. Attachment D ZA23-0042 Page 1 SURROUNDING PROPERTY OWNERS MAP SPO # Owner Zoning Physical Address Acreage Response 1 3503 RP SOUTHLAKE CORNERS KIMB C3 200 N KIMBALL AVE 0.450326913 NR 2 SOUTHLAKE SPE SOUTH LLC SP1 2225 E SOUTHLAKE BLVD 1.814430852 F 3 GREENWAY-1709 ELEVEN PARTNERS SP1 2175 E SOUTHLAKE BLVD 2.750914146 NR 4 BENNER HOLDINGS LLC SP1 2171 E SOUTHLAKE BLVD 1.104355599 F 5 GATEWAY CHURCH CS 2121 E SOUTHLAKE BLVD 3.651109183 U 6 SOUTHLAKE SPE SOUTH LLC SP1 2245 E SOUTHLAKE BLVD 2.351795235 F 7 CARROLL, ISD CS 400 S KIMBALL AVE 3.484798857 O 8 CHAPMAN, GREG SF1-A 211 EASTWOOD DR 0.19746644 NR 9 STRAFACE, ANGELA SF1-A 213 EASTWOOD DR 0.332830816 NR 10 SUPERINTENDENT OF CARROLL ISD O 1000 GREENWAY-1709 ELEVEN PARTNERS B1 2185 E SOUTHLAKE BLVD 8.090436387 NR Responses: F: In Favor O: Opposed U: Undecided NR: No Response Notices Sent: 11 Responses Received within 300’: In Favor: 2 Opposed: 1 Undecided: 1 Responses Received outside 300’: In Favor: 0 Opposed: 31 Undecided: 0 P&Z Comment Cards: In Favor: 2 Opposed: 17 Undecided: 0 Case No. Attachment E ZA23-0042 Page 1 NOTICE RESPONSES WITHIN 300’ 9/7/23, 7:51 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQACjAXYXXMZtIlL%2BR5VRwEJE…1/1 Letter of Suppor t for ZA23-0042,2815 E Southlake Blvd. Rezoning John Benner <John.Benner@ethanallen.com> Wed 9/6/2023 5:07 PM To:DG-PlanningSubmittal <PlanningSubmittal@Ci.Southlake.Tx.Us>;Reagan Rothenberger <RRothenberger@ci.southlake.tx.us> Dear Councilmembers and Commissioners, I am a local business owner and neighbor of the proposed zoning request. I am wring you a leer to let you know that I am in support of the proposed development for Floor and Decor. This development will be a posive impact on my business and the Southlake community. This will be a posive impact to the retail dynamics of Southlake. I support the rezoning and the addion of Floor and Decor to 2815 E. Southlake Blvd. Regards John Benner President/General Manager Benner's Carriage House Inc. An Authorized Ethan Allen Retailer 2171 E. Southlake Blvd. Southlake TX 76092 817.488.9888 Case No. Attachment E ZA23-0042 Page 2 NOTICE RESPONSES OUTSIDE 300’ 9/19/23, 3:47 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAP63B8ySXhdIpEvuvGxbZZk%3D 1/2 FW: Floor & Decor’s proposal Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/19/2023 3:47 PM To:Morgan Barclay MBarclay@ci.southlake.t .us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 19, 2023 3:43 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Floor & Decor’s proposal Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Jacque Baughman Sent: Tuesday, September 19, 2023 2:24 PM To: Council Member Talley <CouncilmemberTalley@cityofsouthlake.com>; Council Member Robbins <CouncilmemberRobbins@cityofsouthlake.com>; Council Member McCaskill <CouncilmemberMcCaskill@cityofsouthlake.com>; Council Member Smith <CouncilmemberSmith@cityofsouthlake.com>; Council Member Lepp <CouncilmemberLepp@cityofsouthlake.com>; Council Member Williamson <CouncilmemberWilliamson@cityofsouthlake.com>; Mayor Huffman <mayor@cityofsouthlake.com> Subject: Floor & Decor’s proposal Mayor and Council members of Southlake, I am opposed to Floor & Decor’s proposed location, 7A and 7B on tonight’s council meeting. I am Jacque Baughman, 1103 Versailles Ct., Southlake, Texas, a 25 year resident of Southlake. 9/19/23, 3:47 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAP63B8ySXhdIpEvuvGxbZZk%3D 2/2 Reasons for my opposition of proposed location of store are….. 1- too close to Dawson & Eubanks schools 2- students walk across the small road north of Dawson, plus this road is the only dedicated road for parents to pick-up students. There should not be additional use from Floor & Decor customer cars, trailers of workers picking up products. 3- small road (only 15 ft. wide) off of E. Southlake Blvd., between BJ’s restaurant & Torchy’s /Salad is already one of the most dangerous intersections. At P&Z meeting, Floor & Decor proposed semi-trucks turning onto this road from westbound & eastbound Southlake Blvd. 4- Floor & Decor cited deliveries from semi-trucks after 10pm. There is a neighborhood very close to the proposed location- they would hear noise from the trucks, fork lifts, etc. 5- a Southlake resident at the P&Z meeting visited other Floor & Decor buildings in the DFW area & found trash behind their buildings- not kept up well. ***Conclude… urge you to vote “no” on this location proposal from Floor & Decor because the location has many serious, safety issues. Thank each of you for your time and efforts you give to our city! Sincerely, Jacque Baughman Sent from my iPhone 9/18/23, 4:45 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAMS0eeEzVHNHhwH%2BVntOsz…1/2 FW: No to Floor & Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/18/2023 4:43 PM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 18, 2023 4:05 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: No to Floor & Decor Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Lori Sent: Monday, September 18, 2023 2:37 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: No to Floor & Decor Dear Mayor Huffman and City Counsel, We strongly oppose the Floor & Decor going in by the middle school. We have four young children that will be at the school eventually and it is very dangerous to have contractors coming in and out of that 9/18/23, 4:45 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAMS0eeEzVHNHhwH%2BVntOsz…2/2 area. Given that we just lost a young child to a bike/car accident, we should be doing everything we can to make sure this doesn’t happen again in our community including looking at the types of businesses and locations we are putting them in. Lori and Ben Berkowitz 1305 Byron Nelson Pkwy SL, 76092 832-754-0264 9/18/23, 4:44 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAARqvyT31IxJspEEfzE1%2B%2B…1/2 FW: Floor and Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/18/2023 4:42 PM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 18, 2023 4:05 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Floor and Decor Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Sarah Biegel Sent: Monday, September 18, 2023 2:37 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Floor and Decor Hello, I am in opposition of the Floor and Decor location by Torchy’s Taco. 9/18/23, 4:44 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAARqvyT31IxJspEEfzE1%2B%2B…2/2 The traffic there is already horrendous. It can take you 15-20 min to go right or left onto Southlake Blvd. The other option for that area is right onto Kimball and goodness, it is going past schools. I do not feel construction workers or delivery drivers on Kimball is a safe option. P&Z already denied the plans 0-6, please do the same. While I would love a Floor and Decor, but that location is not good for it. Sincerely, Sarah Biegel 9/18/23, 4:44 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAIOT%2FnraxD9HuYkmPq6Xr6Q…1/2 FW: Floor and Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/18/2023 4:42 PM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 18, 2023 4:05 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Floor and Decor Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Taty bromley Sent: Monday, September 18, 2023 4:03 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Floor and Decor For the safety of our kids, I ask for their approval to be denied. Thank you’ Tatiane Bromley 9/18/23, 4:44 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAIOT%2FnraxD9HuYkmPq6Xr6Q…2/2 Sent from my iPhone 9/18/23, 10:11 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAB56i2sEm6NIkwgLELLA9vs%3D 1/2 FW: No to Floor & Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/18/2023 10:11 AM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 18, 2023 10:07 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: No to Floor & Decor Forwarding email below... Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Heidi Bryan Sent: Monday, September 18, 2023 10:00 AM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: No to Floor & Decor Mayor & City Council, I am emailing to show opposition to allowing Floor & Decor to build the HUGE box store in Southlake. We will lose the feel to our beautiful community if we start allowing these huge stores to take over. I'm 9/18/23, 10:11 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAB56i2sEm6NIkwgLELLA9vs%3D 2/2 happy to drive outside of Southlake if needed to visit an establishment of this type because I just don't see a NEED for this establishment here, next to the middle school. It is NOT NEEDED. Thank you, Heidi & Mark Bryan 712 Sussex Ct SL 76092 Public Comment Form Your participation in all public meetings is valued and citizens wishing to express their views can electronically submit this Public Comment Form for any topic or agenda item. Please specify where you would like your comments to appear below and enter the required information. (***All comments must be submitted by 5:00 p.m. on the meeting date and will be provided for the record***) Citizens have the option to watch the City Council or PZ Commission meetings online or on the cable channel rather than in person. Citizens wishing to address the City may submit comments on any topic or agenda item electronically by utilizing this Public Comment Form below. Public Meeting Date Board Meeting * * * I wish to share my views on an Agenda Item: Agenda Item No.* * Comments: Signature:* 9/7/2023 Planning and Zoning Commission First and Last Name Audrey Cater Address 1421 Brighton Ct Phone 2488402430 Email 1 (i.e., 1A) I will speak in SUPPORT of this item I will speak in OPPOSITION to this item I do not wish to speak, but please record my: OPPOSITION Change zoning: B-1 to S-P-1 "Floor and Décor" is a huge concern for the community! The first and foremost is Safety. The additional foot /vehicle traffic creates very real safety problems. Increased opportunity for child abduction-interactions/crime and vehicle to pedestrians accidents. Please NO (300 character limit) Public Comment Form Your participation in all public meetings is valued and citizens wishing to express their views can electronically submit this Public Comment Form for any topic or agenda item. Please specify where you would like your comments to appear below and enter the required information. (***All comments must be submitted by 5:00 p.m. on the meeting date and will be provided for the record***) Citizens have the option to watch the City Council or PZ Commission meetings online or on the cable channel rather than in person. Citizens wishing to address the City may submit comments on any topic or agenda item electronically by utilizing this Public Comment Form below. Public Meeting Date Board Meeting * * * I wish to share my views on an Agenda Item: Agenda Item No.* * Comments: Signature:* 9/7/2023 Planning and Zoning Commission First and Last Name Russell Cater Address 1421 Brighton Ct Phone 616-886-1740 Email 1 (i.e., 1A) I will speak in SUPPORT of this item I will speak in OPPOSITION to this item I do not wish to speak, but please record my: OPPOSITION Protect our little Dragons - Please record my Opposition to the changes proposed for a Floor and Décor rezone. (300 character limit) 9/18/23, 10:13 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAMcCzKB%2Fcx1LqAAje34gtlI%3D 1/2 FW: No to Floor and Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/18/2023 10:11 AM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 18, 2023 10:07 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: No to Floor and Decor Forwarding email below... Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Lindsey Castner Sent: Monday, September 18, 2023 9:07 AM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: No to Floor and Decor Good Morning, My name is Lindsey Castner and I live at 1215 concord ave in southlake. Next year, I will have a student at Eubanks and another will be at the eubanks/Dawson campus in 3 years. Please vote no to floor and 9/18/23, 10:13 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAMcCzKB%2Fcx1LqAAje34gtlI%3D 2/2 decor to keep our students safe. The traffic, people, and large commercial building does not belong next to our schools. We have already had a student die this year being hit by a car while on her bike. I do not want another death or injury because a commercial vehicle doesn’t see them. Please do not allow floor and decor in our community. Lindsey Castner Sent from my iPhone 9/18/23, 10:14 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQACdqnMfhU41EnRVKXjDmB%2B…1/2 FW: Floor & Decor Zoning Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/18/2023 10:11 AM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 18, 2023 10:08 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Floor & Decor Zoning Forwarding email below... Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Macy Mitchell Sent: Monday, September 18, 2023 8:43 AM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Floor & Decor Zoning To whom it may concern, My name is Macy Cranston, address 1005 Carroll Meadows Court, Southlake 9/18/23, 10:14 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQACdqnMfhU41EnRVKXjDmB%2B…2/2 I am emailing to express my concern regarding Floor & Decor’s interest in the space next to Dawson Middle school. The intersection at Kimball and 1709 as well as the area of South Kimball is already a hazard for our students and residents. The intersection cannot handle more traffic, let alone daily deliveries from 18 wheelers. I hope the city does right by its citizens and denies any more attempts for floor and decor to take residence in this space. Thank you for your time! Macy Cranston Sent from my iPhone 9/19/23, 9:10 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQACszdgKwGUZKnwWGcfbfvKo%3D 1/2 FW: NO Floor N Decor!!! Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/19/2023 8:59 AM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 18, 2023 5:44 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: NO Floor N Decor!!! Forwarding email below... Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Gina C. Sent: Monday, September 18, 2023 5:41 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: NO Floor N Decor!!! To Whom It Concerns: My family has lived in Southlake for 6 years. My three children attend the Southlake public schools. 9/19/23, 9:10 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQACszdgKwGUZKnwWGcfbfvKo%3D 2/2 We have huge concerns regarding the possible construction of Floor N Decor in Southlake. I have walked by the potential site numerous times and witnessed that the proximity is much too close to Dawson Middle School. It will bring truckers, illegal immigrants, and construction workers directly next to the school, which is a risk for the children right next door. It’s currently zoned for small businesses and us parents don’t even want those built. In general, I have seen too many buildings go up in Southlake and the mass construction is erasing the natural beauty of our town. I do NOT agree with anything more being built at this time. We will NOT stand for this Floor N Decor to be built near our children’s schools. I can’t believe this is even considered in Southlake next door to a school. NO MORE BUILDING! With Great Concern, Gina Crosby 9/18/23, 3:19 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAOTiJUpej4FGk2LKj%2Bug3vk%3D 1/2 FW: Floor and decor proposal Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/18/2023 3:13 PM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 18, 2023 2:23 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Floor and decor proposal Forwarding email below... Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Heather Curtis Sent: Monday, September 18, 2023 12:56 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Floor and decor proposal I am writing to express my extreme dissatisfaction with the floor and decor proposal. It’s a hard pass on that location for a store like that. It exposes our youth in a way that is not acceptable as well as traffic patterns and large trucks in a place that is too small and not meant for those kinds of Vehicle. Please vote NO. There are other alternatives if they would like a store in southlake but our visit e a and 9/18/23, 3:19 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAOTiJUpej4FGk2LKj%2Bug3vk%3D 2/2 children’s well being should come First. Heather Curtis 847-224-2721 Sent from my iPhone 9/11/23, 4:20 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAI5HPu5k5mNEjjstCrMoNDI%3D 1/2 FW: No to Floor and Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/11/2023 4:19 PM To:Morgan Barclay MBarclay@ci.southlake.t .us Please add to the file From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 11, 2023 4 11 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW No to Floor and Decor Forwarding email Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817 748 8016 |ashelley@ ityofsouthlake om www ityofsouthlake om We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Jennifer Sent: Monday, September 11, 2023 3 54 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: No to Floor and Decor Dear Mayor Huffman & City Council Members, On September 7th, 2023 Floor & Decor presented plans for a proposed location at 2185 E Southlake Blvd, Southlake TX to our community at the Planning & Zoning Committee meeting. While I appreciate the effort the Floor & Decor team has put into this project, I would like to express my strong opposition to the property immediately adjacent to a school I am concerned about student safety as well as increased traffic in the already congested area. I hope that both Floor & Decor and the City of Southlake 9/11/23, 4:20 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAI5HPu5k5mNEjjstCrMoNDI%3D 2/2 representatives will consider the ongoing safety risks associated with this site moving forward. Thank you for your consideration. Sincerely, Jennifer Greever Sent from my iPhone 9/11/23, 4:21 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAK5ZtzFOc%2FpGgd0R56GaVjs…1/2 FW: NO Floor & Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/11/2023 4:19 PM To:Morgan Barclay MBarclay@ci.southlake.t .us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 11, 2023 4 11 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW NO Floor & Decor Forwarding email Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve Plea e take a few minute to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Cindy Grossman Sent: Saturday, September 9, 2023 2:17 PM To: Mayor Huffman mayor@cityofsouthlake com Subject: NO Floor & Decor Dear Mayor Huffman, I would like to express my opposition to the proposed zoning change from B-1 to S P 1 for the 60,000 sq. foot Floor & Decor at 2185 E. Southlake Blvd. My irst concern is the safety of our children. Why would anyone think that having semi trucks arriving through out the day, as well as the 75+ cars and trucks/day they are projecting ,and sharing a road with all the parents that come to pick up their children a wise decision? Seriously people? My next concern is the exit onto 1709 from the Torchy’s parking lot. I have seen an accident at the location with a car lipped on its top trying to get out of that parking lot. 9/11/23, 4:21 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAK5ZtzFOc%2FpGgd0R56GaVjs…2/2 Now you want to add pick up trucks pulling lat bed trailers loaded with tile, grout, wood looring and glue trying to turn West onto 1709?? Once again, why would anyone think that is a good idea and beneits the citizens of Southlake? Please use common sense and listen to our concerns when it comes to Floor & Décor. If P&Z voted unanimously for NO zoning change, why is it even going to City Council. We really would like some transparency on this one. Please vote NO on this issue. Regards, Cindy Grossman 217 Westwood Drive Southlake, TX 817-821-6613 9/19/23, 11:59 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAC3IbV3Dq0lLgWP22yXKF1I%3D 1/2 FW: Opposed to Floor and Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/19/2023 11:01 AM To:Morgan Barclay MBarclay@ci.southlake.t .us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 19, 2023 10 56 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW Opposed to Floor and Decor Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817 748 8016 |ashelley@ ityofsouthlake om www ityofsouthlake om We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Donna Grupp Sent: Tuesday, September 19, 2023 10 34 AM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Opposed to Floor and Decor Thanks to all of you for everything you do for our great city of Southlake. My name is Donna Grupp and I live at 222 Westwood Drive in Southlake, Texas and have for 36 years. I am opposed to Floor and Decor in the location adjacent to both Dawson Middle School and Eubanks Intermediate School and abutting a residential neighborhood. The driveway they want to use for access for their deliveries, is just that, a large driveway, never intended for traffic use by 18 wheelers no matter what time of the day or night they claim deliveries would be made. Thank you all for your service to our city. Sincerely, 9/19/23, 11:59 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAC3IbV3Dq0lLgWP22yXKF1I%3D 2/2 Donna Grupp Donna Grupp, ABR Keller Williams Realty DFW 817 975 4472 9/19/23, 2:02 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAPpFEzZeqt5ApCC94HuAsmM%…1/2 FW: Floor & Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/19/2023 12:53 PM To:Morgan Barclay MBarclay@ci.southlake.t .us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 19, 2023 12 49 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW Floor & Decor Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817 748 8016 |ashelley@ ityofsouthlake om www ityofsouthlake om We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Ray G Sent: Tuesday, September 19, 2023 12 37 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Floor & Decor I am vehemently opposed to zoning change to allow Floor & Decor to build at the proposed locaon,it will greatly impact traffic in that area,and the proposed ulizaon of a driveway to access the store is ridiculous,plus the impact to the schools and neighborhood backing up to the proposed project By going to city council aer P&Z turned it down and cizens objecons,it’s purely a corporate power play,because they didn’t get what they wanted I do not think it is project Southlake wants or needs,and thank you for your me and service to this community. Ray Grupp 222 Westwood Dr Southlake,Tx 9/19/23, 2:02 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAPpFEzZeqt5ApCC94HuAsmM%…2/2 Sent from the all new AOL app for iOS 9/12/23, 9:54 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAD1WmzP3MkVPkFBRIq7tjd4%3D 1/2 FW: Floor and decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/12/2023 8:47 AM To:Morgan Barclay MBarclay@ci.southlake.t .us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 12, 2023 8 43 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW Floor and decor Forwarding email below Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve Plea e take a few minute to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Barbara Hargan Sent: Monday, September 11, 2023 5:07 PM To: Mayor and City Council mayorandcitycouncil@cityofsouthlake com Subject: Floor and decor Dear Mayor Huffman & City Council Members, On September 7th, 2023 Floor & Decor presented plans for a proposed location at 2185 E Southlake Blvd, Southlake TX to our community at the Planning & Zoning Committee meeting. While I appreciate the effort the Floor & Decor team has put into this project, I would like to express my STRONG opposition to the property immediately adjacent to a school and residential community being rezoned. The Floor & Decor in Glendale, AZ is immediately adjacent to a school like the proposed site. It shows liquid runoff going from Floor & Decor to the school, a semi truck parked directly along the fence line, and substantial debris outside. These 9/12/23, 9:54 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAD1WmzP3MkVPkFBRIq7tjd4%3D 2/2 environmental concerns would be directly next to children outside the school location. I am concerned about student safety as well as increased traffic in the already congested area. I hope that both Floor & Decor and the City of Southlake representatives will consider the ongoing safety and legal risks associated with this site moving forward. I Can not express how lucky I feel to live in a community that values education the way southlake does - this honestly seems like a it would be a huge mistake! Thank you for your consideration Sincerely, Barbara hartigan 9/8/23, 9:34 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAMHFv7eskBJArrfa%2BJNpSVA…1/2 FW: Please move to another location Jennifer Crosby <jcrosby@ci.southlake.tx.us> Fri 9/8/2023 9:34 AM To:Morgan Barclay MBarclay@ci.southlake.t .us Please add to the file From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Friday, September 8, 2023 9 27 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW Please move to another locaon Forwarding email below Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817 748 8016 |ashelley@ ityofsouthlake om www ityofsouthlake om We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Sent: Thursday, September 7, 2023 5 57 PM To: Subject: Please move to another locaon On April 23rd, 2023 Floor & Decor presented conceptual plans for a proposed location at 2185 E Southlake Blvd, Southlake TX to our community at the Southlake Program for the Involvement of Neighborhoods (SPIN) meeting While I appreciate the effort the Floor & Decor team has put into this project, I would like to express the 9/8/23, 9:34 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAMHFv7eskBJArrfa%2BJNpSVA…2/2 community's strong feedback against the development being immediately adjacent to a school and residential community. As a concerned member of the community, I urge Floor & Decor to reconsider building on this site. You can expect continued opposition from the community if you proceed with this plan Instead, I encourage Floor & Decor to select one of the many other suitable sites in the area. The Floor & Decor in Glendale, AZ is immediately adjacent to a school like the proposed site. It shows liquid runoff going from Floor & Decor to the school, a semi truck parked directly along the fence line, and substantial debris outside These environmental concerns would be directly next to children outside the school location. I am concerned about student safety as well as increased traffic in the already congested area I hope that both Floor & Decor and the City of Southlake representatives will consider the ongoing safety and legal risks associated with this site moving forward. Thank you for your consideration. Sincerely, Kathy Kelsey 9/11/23, 4:20 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAG%2B6KV698ARJvmWaMhMM…1/5 FW: Floor & Decor Proposed Plans 2185 E Southlake Blvd. Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/11/2023 4:19 PM To:Morgan Barclay MBarclay@ci.southlake.t .us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 11, 2023 4 11 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW Floor & Decor Proposed Plans 2185 E Southlake Blvd Forwarding email Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve Plea e take a few minute to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Meghan Kinslow Sent: Monday, September 11, 2023 9:19 AM To: Mayor and City Council mayorandcitycouncil@cityofsouthlake com Subject: Floor & Decor Proposed Plans- 2185 E Southlake Blvd. Hi Mayor & Members of City Council, Thank you all for serving our community. I'm reaching out in regards to the Floor & Decor location proposed at 2185 E Southlake Blvd to share my trong oppo ition to their plan and rezoning reque t. I under tand Floor & Decor i moving forward with presenting plans at the September 19th City Council meeting, despite the Planning & Zoning Committee denying their reque t la t week. While I voiced my concern in per on at the April 23rd SPIN meeting, a well a at the September 7th Planning & Zoning meeting, unfortunately I am not able to make the meeting on September 19th due to a prior work commitment. 9/11/23, 4:20 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAG%2B6KV698ARJvmWaMhMM…2/5 I al o wanted to hare additional concerning information beyond the traffic and afety concern already raised at the meetings by myself and others. In reviewing Floor & Decor locations, I could only find one adjacent to a school like they are propo ing. The atellite image of the Glendale AZ location how liquid run off going from the tore to the school, as well as a semi truck parked directly next to the fence line. Several other locations show ub tantially more debri than their retail neighbor . I'm e tremely concerned about con truction debris being adjacent to the fields kids are playing sports on throughout the day. Floor & Decor -5880 W Bell Rd, Glendale, AZ 85308- Debris stored outside of the store & run off toward chool Additional view of liquid run off going toward school adjacent to Floor & Decor - 9/11/23, 4:20 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAG%2B6KV698ARJvmWaMhMM…3/5 Material and debri tored out ide of Floor & Decor v other retail location I am also concerned about the Floor & Decor executive team's commitment to safety. Their Director of Con truction & De ign publically po t weekly meme on LinkedIn mocking afety and in pection . Colleen Darwin, Director of Real Estate, who attended the April 23rd SPIN meeting on behalf of Floor & Decor, al o liked the e po t on LinkedIn. Sample creen hot are below 9/11/23, 4:20 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAG%2B6KV698ARJvmWaMhMM…4/5 9/11/23, 4:20 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAG%2B6KV698ARJvmWaMhMM…5/5 I hope that the City Council will consider these additional risks in your reviews of the Floor & Decor plans. Thank you, Meghan Kinslow 2054 Miracle Point Dr. Southlake TX 76092 Materials and debris stored outside of Floor & Decor vs other retail locations- I am also concerned about the Floor & Decor executive team's commitment to safety. Their Director of Construction & Design publically posts weekly memes on LinkedIn mocking safety and inspections. Colleen Darwin, Director of Real Estate, who attended the April 23rd SPIN meeting on behalf of Floor & Decor, also liked these posts on LinkedIn. Sample screen shots are below- From: Meghan Kinslow Sent: Saturday, July 15, 2023 7:26 PM To: Reagan Rothenberger <rrothenberger@ci.southlake.tx.us> Subject: Floor & Decor Southlake Plans Hi Reagan, Hope you are doing well. I'm reaching out as another community member concerned about Floor & Decor's plans at 2184 E Southlake Blvd passed along your information. Can you please let me know if Floor & Decor is still planning to present plans on 8/3? Any details would be greatly appreciated as we would like to make sure the Planning & Zoning Commission are aware of the community's concerns. Thank you, Meghan -- Meghan Kinslow 310-691-0346 -- Meghan Kinslow 9/12/23, 4:26 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQANNpPQE2DllJj6mSXEmwmxo%3D 1/2 FW: NO Floor & Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/12/2023 4:18 PM To:Morgan Barclay MBarclay@ci.southlake.t .us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 12, 2023 2:15 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: NO Floor & Decor Forwarding email below… Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Amanda Krebs Sent: Tuesday, September 12, 2023 10:52 AM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: NO Floor & Decor Hello, Next month marks my 13th year as a Southlake resident and I want to express that I strongly oppose the rezoning proposal (Floor & Decor) of the property immediately adjacent to Eubanks Intermediate, and Dawson Middle Schools, where I have children attending both schools. I strongly oppose ANY large facility like this being put that close to my children’s schools where workers, large equipment and traffic will become a huge safety concern as well as a traffic issue. I take great pride in the fact that we have a secure community and knowing that my children are safe when they are entering and leaving school. But this zoning proposal goes against everything that I feel is 9/12/23, 4:26 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQANNpPQE2DllJj6mSXEmwmxo%3D 2/2 ethical for our city. Thank you for your time, Amanda Krebs 9/12/23, 4:25 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAEpaSAJLSfBJklmOQB6OXr4%3D 1/2 FW: Strong Opposition to Zoning Change Request for Floor & Decor Facility Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/12/2023 4:18 PM To:Morgan Barclay MBarclay@ci.southlake.t .us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 12, 2023 2 15 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW Strong Opposion to Zoning Change Request for Floor & Decor Facility Forwarding email below Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817 748 8016 |ashelley@ ityofsouthlake om www ityofsouthlake om We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Devin Krebs Sent: Tuesday, September 12, 2023 11 33 AM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Strong Opposion to Zoning Change Request for Floor & Decor Facility Dear Mayor Huffman & Esteemed City Council Members, I hope this message finds you well I am wring to you today as a concerned cizen of Southlake, deeply troubled by the proposed zoning change for the Floor & Decor facility at 2185 E Southlake Blvd. The potenal implicaons of this change on our community, parcularly the proximity to George Dawson Middle School, Eubanks Intermediate School, and the surrounding residenal areas, have raised significant concerns that cannot be ignored The recent presentaon by Floor & Decor on September 7th, 2023, showcased their intenons for the proposed facility. While I appreciate their efforts, I must emphasize my strong opposion to the rezoning of a property immediately adjacent to our schools and residenal neighborhood The Floor & Decor locaon in Glendale, AZ, which shares similaries with the proposed site, has brought forth alarming environmental issues. 9/12/23, 4:25 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAEpaSAJLSfBJklmOQB6OXr4%3D 2/2 The Glendale site's satellite photo displays liquid runoff from Floor & Decor towards the adjacent school, a semi truck parked directly along the fence line, and substanal debris scaered outside the property boundaries. These troubling environmental concerns are not only detrimental to the ecosystem but, more importantly, pose a direct threat to the safety and well-being of the children who aend the neighboring school. Our community's students deserve a safe and secure learning environment, free from any potenal hazards Furthermore, I am deeply concerned about the impact this proposed facility will have on traffic in an already congested area. The proximity of George Dawson Middle School and Eubanks Intermediate School makes student safety paramount, and an influx of tractor trailer trucks in the vicinity could significantly compromise that safety I implore both Floor & Decor and the City of Southlake representaves to carefully consider the long term safety and legal risks associated with this proposed site. The potenal consequences to our community's well-being, especially our children, cannot be overlooked or underesmated In light of these concerns, I respecully request that you vote against the plans for the Floor & Decor facility and the rezoning of the property next to our schools. Your decision will not only shape the future of our community but also ensure the safety and security of our children Thank you for your me, aenon, and dedicaon to serving our beloved city Your commitment to the well being of Southlake is deeply appreciated, and I trust that you will make the right choice to protect our community's interests Sincerely, Devin Krebs 1220 Westmont Drive Southlake, TX 76092 9/12/23, 9:55 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQALQCFwcmkVBFrFEvLLn0RCI%3D 1/2 FW: Public Hearing 23 0042 Zone Change Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/12/2023 8:47 AM To:Morgan Barclay MBarclay@ci.southlake.t .us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 12, 2023 8:42 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Public Hearing 23-0042 Zone Change Forwarding email below… Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Lora Krebs Sent: Tuesday, September 12, 2023 8:35 AM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Public Hearing 23-0042 Zone Change The Honorable John Huffman and City Council Member, Southlake is justly recognized as Excellence in Community, Family, Schools, and also includes shopping and dining. All of this is because of the love and work each of you have diligently committed and continue to creating. As a Grandparent, I wish to address concerns of zone change for Floor N Decor proposal. I drop and pick up my grand children as well as attend school functions. 9/12/23, 9:55 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQALQCFwcmkVBFrFEvLLn0RCI%3D 2/2 This literally upsets my stomach to think of the kids attending Eubanks and Dawson on Kimball. Just dropping off and pick up, waiting in lines in the street; Kimball Ave is a very hilly and busy street now, when pulling out of the campus, it’s difficult to judge to pull out, shrubs and trees already block some of the view pulling onto Kimball Ave. To think possibly, there could be added vehicles and especially, 18-Wheelers to this current traffic. Your schools are not just education classes, there are constant events, sports, programs, and more, all hours of the day. This Zone Change would not allow one student to be able to ride their bicycle. Every child should have that tradition and option of riding a bike to school. I am so very grateful for all you do for your city. I’m so thankful my son and his family live there and are raising wonderful children in your wonderful community. Floor N Decor have so many more options, than to propose a location near two school campuses and also near the football stadium, again serious traffic and safety concerns. There are numerous options and areas else where for them to succeed. Thank you again for all you do, praying you will honor the people of Southlake, who voted for you. God Bless, Lora Krebs A concerned Grandparent 9/12/23, 9:56 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQABNqKfgPYblEvbGW9nQG%2FE…2/2 environmental concerns would be directly next to children outside the school location. I am concerned about student physical safety as well as increased traffic in the already congested area. I hope that both Floor & Decor and the City of Southlake representatives will consider the ongoing safety and legal risks associated with this site moving forward. Thank you for your consideration. Sincerely, Teri Larson 1306 Forest Hill’s Ct Southlake, TX 76092 469-491-9472 Sent from my iPhone 9/12/23, 9:55 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAHSSJ6dRXoFLnQjcE34RnYU%3D 1/2 FW: Floor and Decor location Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/12/2023 8:47 AM To:Morgan Barclay MBarclay@ci.southlake.t .us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 12, 2023 8 42 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW Floor and Decor locaon Forwarding email below Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve Plea e take a few minute to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Sent: Monday, September 11, 2023 8:00 PM To: Mayor and City Council mayorandcitycouncil@cityofsouthlake com Subject: Floor and Decor locaon Dear Mayor Huffman & City Council Members, On September 7th, 2023 Floor & Decor presented plans for a proposed location at 2185 E Southlake Blvd, Southlake TX to our community at the Planning & Zoning Committee meeting. While I appreciate the effort the Floor & Decor team has put into this project, I would like to express my very strong opposition to the property immediately adjacent to a school and residential community being rezoned. The Floor & Decor in Glendale, AZ is immediately adjacent to a school like the proposed site. It shows liquid runoff going from Floor & Decor to the school, a semi truck parked directly along the fence line, and substantial debris outside. These 9/12/23, 9:55 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAHSSJ6dRXoFLnQjcE34RnYU%3D 2/2 environmental concerns would be directly next to children outside the school location. As both a Southlake resident and father of a student at Dawson Middle School, I am concerned about student safety as well as increased traffic in the already congested area I am also very concern about the potential gathering of day workers so close to the Intermediate and Middle School. I hope that the City of Southlake representatives will consider the ongoing safety and legal risks associated with this site moving forward. Thank you for your consideration Sincerely, Marty Mendivil 2717 York Ct Southlake Tx, 76092 9/18/23, 3:20 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAIcA1u6%2B3HhNmYsJQb5%2F…1/2 FW: Opposition to Floor and Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/18/2023 3:13 PM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 18, 2023 2:23 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Opposion to Floor and Decor Forwarding email below… Amy Shelley, TRMC City Se retary | City of Southlake 1400 Main St Ste 270 Southlake TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are alway looking for input and way to continue to improve. Please take a few minutes to complete the hort Customer Service feedback form. Confidentiality Notice: This e mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Madison Orser <> Sent: Monday, September 18, 2023 1:46 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Opposion to Floor and Decor Dear City Counsel Members, As a resident of the city of Southlake, I would like to express my strong opposition to the proposed rezoning of the Floor and Decor proposed location at 2185 E Southlake Blvd. I am strongly opposed to the property immediately adjacent to a school and residential community being rezoned. 9/18/23, 3:20 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAIcA1u6%2B3HhNmYsJQb5%2F…2/2 In addition to environmental concerns, I am concerned about student safety as well as increased traffic in the already congested area. I hope that the City of Southlake representatives will consider the ongoing safety and legal risks associated with this site moving forward. Thank you for your consideration. Sincerely, Madison Orser 9/18/23, 10:13 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAMNTI6M91qBJmJG1nVXwygQ…1/2 FW: Floor and Decor opposition Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/18/2023 10:11 AM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 18, 2023 10:07 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Floor and Decor opposition Forwarding email below... Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Jennifer Powers Sent: Monday, September 18, 2023 8:56 AM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Floor and Decor opposition Hello, May name is Jennifer Powers and my family of five including 3 small children live at 508 Saint Laurent CT in Southlake. 9/18/23, 10:13 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAMNTI6M91qBJmJG1nVXwygQ…2/2 We are in strong opposition of Floor and Decor resuming their plans of building next to the schools our children will attend, Dawson and Eubanks. A residential and school area is no place for 18 wheelers and large trucks as our children ride their bikes to school. The traffic would be a nightmare. We are petrified of the potential plans and ask for them to be denied. This is a direct threat to the safety of our children and community members and we pray the right decisions will be made,as this is NOT the right area for this type of warehouse. Thank you, Jennifer Sent from my iPhone 9/19/23, 3:48 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAFTxy2QeaBJFhVbmXwtsnwg%3D 1/2 FW: Opposition to Floor & Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/19/2023 3:47 PM To:Morgan Barclay MBarclay@ci.southlake.t .us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 19, 2023 3 43 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW Opposion to Floor & Decor Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817 748 8016 |ashelley@ ityofsouthlake om www ityofsouthlake om We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Jeffrey Prokop Sent: Tuesday, September 19, 2023 1 44 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Opposion to Floor & Decor To whom it may concern On April 23rd, 2023, Floor & Decor presented conceptual plans for a proposed location at 2185 E Southlake Blvd, Southlake TX to our community at the Southlake Program for the Involvement of Neighborhoods (SPIN) meeting While I appreciate the effort the Floor & Decor team has put into this project, I would like to express the community's strong feedback against the development being immediately adjacent to a school and residential community and note that there are plenty of other suitable locations in our area With recent tragic vehicular/ pedestrian events in our community, we must be mindful of the perils of allowing this store to be built next to our schools. I am concerned about student safety as well as increased traffic in the already congested area. Traffic is already a consistent issue in the area during school drop off and pick up as well as for various school/ sports 9/19/23, 3:48 PM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAFTxy2QeaBJFhVbmXwtsnwg%3D 2/2 events A delivery driveway adjacent to Dawson Middle School also poses many safety concerns In addition, the increased traffic through the Kimball/ 1709 intersection (already very congested and prone to accidents) is a safety concern. Presumably, there would be a dramatic increase in traffic through that intersection coming from Hwy 114 As I understand it, the types of trucks that will be accessing Floor and Decor are of the large, load bearing variety that also pose a risk of damaging our streets. The Floor & Decor in Glendale, AZ is immediately adjacent to a school like the proposed site It shows liquid runoff going from Floor & Decor to the school, a semi truck parked directly along the fence line, and substantial debris outside. These environmental concerns would be directly next to children outside the school location. I hope that both Floor & Decor and the City of Southlake representatives will consider the ongoing safety and legal risks associated with this site moving forward. Thank you for your consideration. Sincerely, Jeffrey Prokop Southlake, TX 9/6/23, 10:39 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAACp42nOy2VMoqxaq7YWL2c%…1/2 FW: Opposition to Floor and Decor Site Jennifer Crosby <jcrosby@ci.southlake.tx.us> Wed 9/6/2023 10:37 AM To:Morgan Barclay MBarclay@ci.southlake.t .us Please add to the file From: Amy Shelley ashelley@ci southlake tx us Sent: Wednesday, September 6, 2023 9:18 AM To: Dennis Killough dkillough@ci southlake tx us ; Jennifer Crosby jcrosby@ci southlake tx us Subject: FW: Opposion to Floor and Decor Site Forwarding email below… Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve Plea e take a few minute to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Hilary Prokop Sent: Wednesday, September 6, 2023 8:55 AM To: Daniel Kubiak Daniel Kubiak@cityofsouthlake com ; Michael Forman ; Ausn Reynolds <Ausn.Reynolds@cityofsouthlake.com>; Gina Phalen <Gina.Phalen@cityofsouthlake.com>; Michael Springer michael springer@cityofsouthlake com ; Stacy Driscoll stacydriscoll@cityofsouthlake com ; lora.gunter@cityofsouthlake.com; Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Opposion to Floor and Decor Site To whom it may concern On April 23rd, 2023, Floor & Decor presented conceptual plans for a proposed location at 2185 E Southlake Blvd, Southlake TX to our community at the Southlake Program for the Involvement of Neighborhoods (SPIN) meeting While I appreciate the effort the Floor & Decor team has put into this project, I would like to express the community's strong feedback against the development being immediately adjacent to a school and residential community and note that there are plenty of other suitable locations in our area 9/6/23, 10:39 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAACp42nOy2VMoqxaq7YWL2c%…2/2 With recent tragic vehicular/ pedestrian events in our community, we must be mindful of the perils of allowing this store to be built next to our schools. I am concerned about student safety as well as increased traffic in the already congested area. Traffic is already a consistent issue in the area during school drop off and pick up as well as for various school/ sports events. A delivery driveway adjacent to Dawson Middle School also poses many safety concerns. In addition, the increased traffic through the Kimball/ 1709 intersection (already very congested and prone to accidents) is safety concern Presumably, there would be a dramatic increase in traffic through that intersection coming from Hwy 114. As I understand it, the types of trucks that will be accessing Floor and Decor are of the large, load bearing variety that also pose a risk of damaging our streets The Floor & Decor in Glendale, AZ is immediately adjacent to a school like the proposed site. It shows liquid runoff going from Floor & Decor to the school, a semi truck parked directly along the fence line, and substantial debris outside. These environmental concerns would be directly next to children outside the school location. I hope that both Floor & Decor and the City of Southlake representatives will consider the ongoing safety and legal risks associated with this site moving forward. Thank you for your consideration Sincerely, Hilary Prokop Southlake, TX 9/19/23, 9:49 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAJ074ORAjUlErSHfXN5MOqQ%3D 2/2 Southlake Sent from my iPhone 9/19/23, 9:13 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAMOnX9x1kNVEuPxBRoec7IU%3D 1/2 FW: Floor and Decor Opposition Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/19/2023 9:04 AM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 19, 2023 9:03 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Floor and Decor Opposion Amy Shelley, TRMC City Se retary | City of Southlake 1400 Main St Ste 270 Southlake TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are alway looking for input and way to continue to improve. Please take a few minutes to complete the hort Customer Service feedback form. Confidentiality Notice: This e mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Maria Stathakis Sent: Tuesday, September 19, 2023 1:38 AM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Floor and Decor Opposion Dear Mayor Huffman & City Council Members, On September 7th, 2023 Floor & Decor presented plans for a proposed location at 2185 E Southlake Blvd. I would like to express my strong opposition to the property immediately adjacent to a school and residential community being rezoned 9/19/23, 9:13 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAMOnX9x1kNVEuPxBRoec7IU%3D 2/2 Floor & Decor is known for it's "always low prices" I personally love a deal, but the Southlake community doesn't do cheap and don't typically DIY. They hire professional contractors. Why make these contractors come into the heart of Southlake when there are great existing options with easy access to the highway available today?!? I am concerned about student safety as well as increased traffic in the already congested area. I am worried for the safety of students, teachers and staff at Dawson & Eubanks, as well as events held at the schools on the weekends There are multiple DYF games scheduled on Saturdays in the fall. It's not just football players/parents but cheerleaders and their parents, coaches, grandparents that are ALL affected. Traffic alone would be a nightmare with large delivery trucks getting to and from the store. I understand our neighborhood has pushed back a lot over the years but hope you understand how much this city, neighborhood and school district mean to us and choose to keep ALL DRAGONS and Southlake safe. Thank you for your consideration. Sincerely, Maria Stathakis 9/12/23, 8:10 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAFRSI%2BUgcL9Dp9qVU jJn%2…1/2 FW: Floor and Decor site Jennifer Crosby <jcrosby@ci.southlake.tx.us> Mon 9/11/2023 4:45 PM To:Morgan Barclay MBarclay@ci.southlake.t .us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Monday, September 11, 2023 4 45 PM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW Floor and Decor site Forwarding email Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve Plea e take a few minute to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Nicole Sckane Sent: Monday, September 11, 2023 4:15 PM To: Mayor and City Council mayorandcitycouncil@cityofsouthlake com Subject: Floor and Decor site Dear Mayor Huffman & City Council Members, On September 7th, 2023 Floor & Decor presented plans for a proposed location at 2185 E Southlake Blvd, Southlake TX to our community at the Planning & Zoning Committee meeting. While I appreciate the effort the Floor & Decor team has put into this project, I would like to express my strong opposition to the property immediately adjacent to a school and residential community being rezoned. The Floor & Decor in Glendale, AZ is immediately adjacent to a school like the proposed site. It shows liquid runoff going from Floor & Decor to the school, a semi truck parked directly along the fence line, and substantial debris outside. These 9/12/23, 8:10 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAFRSI%2BUgcL9Dp9qVU jJn%2…2/2 environmental concerns would be directly next to children outside the school location. I am concerned about student safety as well as increased traffic in the already congested area. I hope that both Floor & Decor and the City of Southlake representatives will consider the ongoing safety and legal risks associated with this site moving forward. Thank you for your consideration. Sincerely, Nicole Sckane C: 817-304-9098 9/19/23, 9:13 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAPpjy0ZQ4dhNr6MbUlXAVwo%3D 1/2 FW: Reject Floor & Decor Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/19/2023 9:03 AM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 19, 2023 9:03 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Reject Floor & Decor Amy Shelley, TRMC City Se retary | City of Southlake 1400 Main St Ste 270 Southlake TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are alway looking for input and way to continue to improve. Please take a few minutes to complete the hort Customer Service feedback form. Confidentiality Notice: This e mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. From: Jason Wang Sent: Monday, September 18, 2023 10:48 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Reject Floor & Decor To Mayor and City Council, Please reject the proposal for a Floor & Decor next to Dawson Middle and Eubanks Intermediate Schools. The locaon is too close to our schools for a store of this type. Other home improvement and building supply stores in Southlake have direct highway service road access and don't compete with school pick-up and drop-off traffic. The proposed Floor & Decor locaon will contribute to increased Southlake Blvd and Kimball Ave traffic, which is already congested at peak mes. Also of concern is that the majority of the Floor and Decor customer base is contractors. I can imagine contractors and their employees rushing into and out of the store, especially around school drop-off mes, to get their projects completed, possibly disregarding school zones and endangering the lives of Southlake children. Increased traffic may also cause parents and caregivers to rush to get children to 9/19/23, 9:13 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAPpjy0ZQ4dhNr6MbUlXAVwo%3D 2/2 school on me, again endangering lives Our community has already suffered the loss of one child this year due to a collision with a motor vehicle, please help limit the opportunies for addional tragedies. Help protect the children of Southlake and reject the proposal from Floor & Decor Jason Wang 721 Winding Ridge Trl, 76092 -- 9/19/23, 9:12 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAFrZZ1TSF1ZAr84g85T2kDU%3D 1/2 FW: Floor & Decor Opposition Jennifer Crosby <jcrosby@ci.southlake.tx.us> Tue 9/19/2023 9:03 AM To:Morgan Barclay MBarclay@ci.southlake.t .us Jenny Crosby, AICP Deputy Director - Planning & Development Services City of Southlake | 1400 Main Street, Suite 310 | Southlake, TX 76092 Direct: (817) 748-8195 | Email: jcrosby@ci.southlake.tx.us -----Original Message----- From: Amy Shelley <ashelley@ci.southlake.tx.us> Sent: Tuesday, September 19, 2023 9:02 AM To: Dennis Killough <dkillough@ci.southlake.tx.us>; Jennifer Crosby <jcrosby@ci.southlake.tx.us> Subject: FW: Floor & Decor - Opposition Amy Shelley Amy Shelley, TRMC City Secretary | City of Southlake 1400 Main St., Ste. 270, Southlake, TX 76092 817.748.8016 |ashelley@cityofsouthlake.com www.cityofsouthlake.com We are always looking for input and ways to continue to improve. Please take a few minutes to complete the short Customer Service feedback form. Confidentiality Notice: This e-mail message, including any attachments is for the sole use of the intended recipient(s) and may contain confidential and privileged information. Any receipt and/or response to this email may be considered a PUBLIC RECORD. If you have received this email in error, please notify the sender immediately. Any unauthorized review, use, disclosure, or distribution is prohibited. -----Original Message----- From: Sent: Monday, September 18, 2023 7:37 PM To: Mayor and City Council <mayorandcitycouncil@cityofsouthlake.com> Subject: Floor & Decor - Opposition Dear Mayor and City Council, Despite a unanimous 6-0 vote by the Planning & Zoning Commission to deny rezoning and Floor & Décor's plans next to Dawson & Eubanks Schools, they are bringing their plans to City Council tomorrow, 9/19/23, 9:12 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQAFrZZ1TSF1ZAr84g85T2kDU%3D 2/2 September 19th at 7:00 PM. Because of the Planning & Zoning denial they now must get a super majority of the City Council to approve their plans. We are STRONGLY OPPOSED to their rezoning request. The request is not in the best interest of Southlake, its citizens, its students, or anyone living in our fair city. Please vote against their proposal - that NO vote represents what is best for Southlake. Thank you, Randy and Connie Woertendyke 917 Edgemeer Lane Southlake, TX 76092 817 899 5677 GO DRAGONS!! Case No. Attachment E ZA23-0042 Page 3 PLANNING AND ZONING COMMISSION MEETING COMMENT CARDS Case No. Attachment F ZA23-0042 Page 1 CITY OF SOUTHLAKE, TEXAS ORDINANCE NO. 480-806 AN ORDINANCE AMENDING ORDINANCE NO. 480, AS AMENDED, THE COMPREHENSIVE ZONING ORDINANCE OF THE CITY OF SOUTHLAKE, TEXAS; GRANTING A ZONING CHANGE ON A CERTAIN TRACT OR TRACTS OF LAND WITHIN THE CITY OF SOUTHLAKE, TEXAS BEING LEGALLY DESCRIBED AS ALL OF AS TRACT 1B02, JOHN A. FREEMAN SURVEY ABSTRACT NO. 529, SOUTHLAKE, TARRANT COUNTY, TEXAS, BEING APPROXIMATELY 7.8 ACRES, AND MORE FULLY AND COMPLETELY DESCRIBED IN EXHIBIT “A” FROM “B-1” BUSINESS SERVICE PARK DISTRICT TO “S-P-1” DETAILED SITE PLAN DISTRICT, AS DEPICTED ON THE APPROVED SITE PLAN ATTACHED HERETO AND INCORPORATED HEREIN AS EXHIBIT “B”, SUBJECT TO THE SPECIFIC REQUIREMENTS CONTAINED IN THIS ORDINANCE; CORRECTING THE OFFICIAL ZONING MAP; PRESERVING ALL OTHER PORTIONS OF THE ZONING ORDINANCE; DETERMINING THAT THE PUBLIC INTEREST, MORALS AND GENERAL WELFARE DEMAND THE ZONING CHANGES AND AMENDMENTS HEREIN MADE; PROVIDING THAT THIS ORDINANCE SHALL BE CUMULATIVE OF ALL ORDINANCES; PROVIDING A SEVERABILITY CLAUSE; PROVIDING FOR A PENALTY FOR VIOLATIONS HEREOF; PROVIDING A SAVINGS CLAUSE; PROVIDING FOR PUBLICATION IN THE OFFICIAL NEWSPAPER; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City of Southlake, Texas is a home rule City acting under its Charter adopted by the electorate pursuant to Article XI, Section 5 of the Texas Constitution and Chapter 9 of the Texas Local Government Code; and, WHEREAS, pursuant to Chapter 211 of the Local Government Code, the City has the authority to adopt a comprehensive zoning ordinance and map regulating the location and use of buildings, other structures and land for business, industrial, residential and other purposes, and to amend said ordinance and map for the purpose of promoting the public health, safety, morals and general welfare, all in accordance with a comprehensive plan; and, WHEREAS, the hereinafter described property is currently zoned as “B-1” Business Case No. Attachment F ZA23-0042 Page 2 Service Park District under the City’s Comprehensive Zoning Ordinance; and, WHEREAS, a change in the zoning classification of said property was requested by a person or corporation having a proprietary interest in said property; and, WHEREAS, the City Council of the City of Southlake, Texas, at a public hearing called by the City Council did consider the following factors in making a determination as to whether these changes should be granted or denied: safety of the motoring public and the pedestrians using the facilities in the area immediately surrounding the sites; safety from fire hazards and damages; noise producing elements and glare of the vehicular and stationary lights and effect of such lights on established character of the neighborhood; location, lighting and types of signs and relation of signs to traffic control and adjacent property; street size and adequacy of width for traffic reasonably expected to be generated by the proposed use around the site and in the immediate neighborhood; adequacy of parking as determined by requirements of this ordinance for off- street parking facilities; location of ingress and egress points for parking and off-street loading spaces, and protection of public health by surfacing on all parking areas to control dust; effect on the promotion of health and the general welfare; effect on light and air; effect on the over- crowding of the land; effect on the concentration of population, and effect on transportation, water, sewerage, schools, parks and other public facilities; and, WHEREAS, the City Council of the City of Southlake, Texas, further considered among other things the character of the districts and their peculiar suitability for particular uses and the view to conserve the value of the buildings, and encourage the most appropriate use of the land throughout this City; and, WHEREAS, the City Council of the City of Southlake, Texas, does find that there is a public necessity for the zoning changes, that the public demands them, that the public interest clearly requires the amendments, and that the zoning changes do not unreasonably invade the Case No. Attachment F ZA23-0042 Page 3 rights of those who bought or improved property with reference to the classification which existed at the time their original investment was made; and, WHEREAS, the City Council of the City of Southlake, Texas, does find that the changes in zoning lessen the congestion in the streets, helps secure safety from fire, panic, and other dangers, promotes the health and the general welfare, provides adequate light and air, prevents the over-crowding of land, avoids undue concentration of population, and facilitates the adequate provision of transportation, water, sewerage, schools, parks and other public requirements; and, WHEREAS, the City Council of the City of Southlake, Texas, has determined that there is a necessity and need for the changes in zoning and has also found and determined that there has been a change in the conditions of the property surrounding and in close proximity to the tract or tracts of land requested for a change since the tract or tracts of land were originally classified and therefore feels that the respective changes in zoning classification for the tract or tracts of land are needed, are called for, and are in the best interest of the public at large, the citizens of the city of Southlake, Texas, and helps promote the general health, safety and welfare of the community. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS: SECTION 1. That Ordinance No. 480, the Comprehensive Zoning Ordinance of the City of Southlake, Texas, passed on the 19th day of September, 1989, as originally adopted and amended, is hereby amended so that the permitted uses in the hereinafter described areas be altered, changed and amended as shown and described below: Being legally described as all of Tract 1B02, John A. Freeman Survey Abstract No. 529, Southlake, Tarrant County, Texas, being approximately 7.8 acres, and more Case No. Attachment F ZA23-0042 Page 4 fully and completely described in Exhibit “A” from “B-1” Business Service Park District to “S-P-1” Detailed Site Plan District, as depicted on the approved site plan attached hereto and incorporated herein as Exhibit “B” and subject to the following conditions: 1. 1. List any conditions SECTION 2. That the City Manager is hereby directed to correct the Official Zoning map of the City of Southlake, Texas, to reflect the herein changes in zoning. SECTION 3. That in all other respects the use of the tract or tracts of land herein above described shall be subject to all the applicable regulations contained in said Zoning Ordinance and all other applicable and pertinent ordinances for the City of Southlake, Texas. All existing sections, subsections, paragraphs, sentences, words, phrases and definitions of said Zoning Ordinance are not amended hereby, but remain intact and are hereby ratified, verified, and affirmed. SECTION 4. That the zoning regulations and districts as herein established have been made in accordance with the comprehensive plan for the purpose of promoting the health, safety, morals and the general welfare of the community. They have been designed, with respect to both present conditions and the conditions reasonably anticipated to exist in the foreseeable future; to lessen congestion in the streets; to provide adequate light and air; to prevent over-crowding of land; to avoid undue concentration of population; and to facilitate the adequate provision of transportation, water, sewerage, drainage and surface water, parks and other commercial needs and development of the community. They have been made after a full and complete hearing with reasonable consideration among other things of the character of the district and its peculiar Case No. Attachment F ZA23-0042 Page 5 suitability for the particular uses and with a view of conserving the value of buildings and encouraging the most appropriate use of land throughout the community. SECTION 5. That this ordinance shall be cumulative of all other ordinances of the City of Southlake, Texas, affecting zoning and shall not repeal any of the provisions of said ordinances except in those instances where provisions of those ordinances are in direct conflict with the provisions of this ordinance. SECTION 6. That the terms and provisions of this ordinance shall be deemed to be severable and that if the validity of the zoning affecting any portion of the tract or tracts of land described herein shall be declared to be invalid, the same shall not affect the validity of the zoning of the balance of said tract or tracts of land described herein. SECTION 7. Any person, firm or corporation who violates, disobeys, omits, neglects or refuses to comply with or who resists the enforcement of any of the provisions of this ordinance shall be fined not more than Two Thousand Dollars ($2,000.00) for each offense. Each day that a violation is permitted to exist shall constitute a separate offense. SECTION 8. All rights and remedies of the City of Southlake are expressly saved as to any and all violations of the provisions of Ordinance No. 480, as amended, or any other ordinances affecting zoning which have accrued at the time of the effective date of this ordinance; and, as to such accrued violations and all pending litigation, both civil and criminal, whether pending in court or not, under such ordinances, same shall not be affected by this ordinance but may be prosecuted Case No. Attachment F ZA23-0042 Page 6 until final disposition by the courts. SECTION 9. The City Secretary of the City of Southlake is hereby directed to publish the proposed ordinance in its entirety on the City website together with a notice setting out the time and place for a public hearing thereon at least ten (10) days before the second reading of this ordinance, and it this ordinance provides for the imposition of any penalty, fine or forfeiture for any violation of any of its provisions, then the City Secretary shall additionally publish this ordinance in the official City newspaper one time within ten (10) days after passage of this ordinance, as required by Section 3.13 of the Charter of the City of Southlake. SECTION 10. This ordinance shall be in full force and effect from and after its passage and publication as required by law, and it is so ordained. PASSED AND APPROVED on the 1st reading the _____ day of _____, 2023. _________________________________ MAYOR ATTEST: _________________________________ CITY SECRETARY PASSED AND APPROVED on the 2nd reading the _____ day of _______, 2023. ________________________________ MAYOR ATTEST: Case No. Attachment F ZA23-0042 Page 7 ________________________________ CITY SECRETARY APPROVED AS TO FORM AND LEGALITY: _________________________________ CITY ATTORNEY DATE:___________________________ ADOPTED:_______________________ EFFECTIVE:______________________ Case No. Attachment F ZA23-0042 Page 8 EXHIBIT “A” Metes and Bounds Description Being a 7.801 acre tract of land situated in the John Freeman Survey, Abstract 529, City of Southlake, Tarrant County, Texas, and being a portion of a called 11.208 acre tract of land as described in Warranty Deed to Greenway-1709/Eleven Partners, L.P. recorded in Instrument No. D197109628, Deed Records, Tarrant County, Texas (D.R.T.C.T.), and being more particularly described by metes and bounds as follows: BEGININNG at the northeast corne r of said 11.208 acre tract, same being the called northwest corner of the Plat Revision of Kimball Oaks, an addition to the City of Southlake, as recorded in Instrument No. D214263624, Plat Records, Tarrant County, Texas (P.R.T.C.T.), said point being on the south right - of-way line of Farm to Market Road No. 1709, also known of as Southlake Boulevard (a variable width right-of-way); THENCE South 00 degrees 02 minutes 16 seconds East, departing said south right-of-way line and with the common east line of said 11.208-acre tract and west line of said Kimball Oaks Addition, a distance of 967.50 feet to a 1/2 -inch iron rod with a yellow plastic cap stam ped “Halff” set for the southeast corner of said 11.208 acre tract and southwest corner of said Kimball Oaks Addition, and being at an angle point in the north line of Lot 1R, Block 1, Carroll ISD No. 4 Addition, an addition to the City of Southlake, as recorded in Instrument No. D20841721, P.R.T.C.T.; THENCE South 89 degrees 48 minutes 13 seconds West, with th e common south line of said 11.208 acre tract and north line of said Carroll ISD No. 4 Addition, a distance of 589.98 feet to 3/8 -inch iron rod found for the southwest corner of said 11.208 acre tract, the northwest corner of said Carroll ISD No. 4 Addition, and being on the east line of Lot 1R, Block 1, Gateway Church Addition, an addition to the City of Southlake, as recorded in Cabinet A, Page 7866 , P.R.T.C.T.; THENCE North 00 degrees 10 minutes 55 seconds West, with the common west line of said 11.208 acre tract and east line of said Gateway Church Addition, a distance of 592.90 feet to a 5/8 -inch iron rod with yellow plastic cap stamped "GSES INC RPLS 4804" found for the southwest corner of Lot 1, Block 1, Ethan Allen 1709 Addition, an addition to the City of Southlake, as recorded in Cabinet A, Page 11456, P.R.T.C.T.; THENCE North 89 degrees 34 minutes 50 seconds East, departing said common line and with the south line of said Ethan Allen 1709 Addition, a distance of 237.38 feet a 5/8 -inch iron rod with yellow plastic cap stamped "GSES INC RPLS 4804" found for the Case No. Attachment F ZA23-0042 Page 9 southeast corner of Lot 1 of said Ethan Allen 1709 Addition, same being on the west line of a Plat Revision of Lot 1R, Block 1, Kimball Crossing, an addition to the City of Southlake, as recorded in Instrument No. D218233726, P.R.T.C.T.; THENCE South 00 degrees 14 minutes 24 seconds East, with west line of said Kimball Crossing Addition , a distance of 50.00 feet to a 1/2-inch iron rod with a yellow plastic cap stamped “Halff” set for the southwest corner of said Kimball Crossing Addition; THENCE North 89 degrees 34 minutes 50 seconds East, along the south line of said Kimball Crossing A ddition, a distance of 341.93 feet to an “X” in concrete set for the southeast corner of said Kimball Crossing Addition; THENCE northerly along the east line of said Kimball Crossing Addition the following calls: North 00 degrees 02 minutes 16 seconds We st, a distance of 372.29 feet to an “X” in concrete set for corner; South 89 degrees 34 minutes 26 seconds W est, a distance of 30.00 feet to a 1/2-inch iron rod found for corner; North 00 degrees 02 minutes 16 seconds West, a distance of 50.00 feet to the most northerly northeast corner of said Kimball Crossing addition, said point lying on the common north line of said Greenway-1709/Eleven Partners, L.P. tract and south right-of-way line of Southlake Boulevard, and from which said point an “X” found in concrete bears North 42 degrees 05 minutes 39 seconds West, a distance of 0.24 feet; THENCE North 89 degrees 3 4 minutes 26 seconds East, along said common north line and south right -of-way line, a distance of 42.00 feet to the POINT OF BEGINNING AND CONTAINING 339,793 square feet or 7.801 acres of land, more or less. Case No. Attachment F ZA23-0042 Page 10 EXHIBIT “B” Reserved for Site Plan From:Cochran, Philip To:Dennis Killough Cc:Dahlstrom, Bill; Morris, Victoria; Reagan Rothenberger; Darwin, Colleen Subject:ZA23-0042 2815 E Southlake Blvd - APPLICANT REQUESTS TO WITHDRAW FOR 2ND READING Date:Monday, September 25, 2023 9:41:41 AM Dennis, Please withdraw ZA23-0042 from your upcoming agenda at the request of the applicant. We will be terminating our purchase contract and not moving forward with this project based on the 1st reading vote by the City Council. Thank you for help during the rezoning process. Could you or your staff confirm receipt of this email and the withdrawal? Best Regards, Philip Cochran Land Development Manager Floor & Decor SSC Location: R16-19B 2500 Windy Ridge Pkwy SE Atlanta, GA 30339 Cell: 770-617-4262 philip.cochran@flooranddecor.com flooranddecor.com This email and any files transmitted with it are the property of Floor & Decor, are confidential, and are intended solely for the use of the individual or entity to which this email is addressed. If you are not one of the named recipient(s) or otherwise have reason to believe that you have received this message in error, please notify the sender at 770-617-4262 and delete this message immediately from your computer. Any other use, retention, dissemination, forwarding, printing, or copying of this email is strictly prohibited. Please consider the environment before printing this email. 37609128v.1 JW | DALLAS 2323 Ross Avenue, Suite 600 • Dallas, Texas 75201 | www.jw.com | Member of GLOBALAW™ September 25, 2023 Mr. Dennis Killough Director of Planning and Development Services City of Southlake 1400 Main Street Southlake, TX 76092 Re: Application Withdrawal – Case Nos. ZA23-0042 and CP23-0001. Dear Dennis: As you know, this Firm acts as a representative in the matters referenced above as authorized by the Property Owner and Applicant of the zoning file. This letter is to serve as our withdrawal of Case Nos. ZA23-0042 and CP23-0001 on behalf of the Owner and the Applicant. Please feel free to contact me if you have any questions. Sincerely, William S. Dahlstrom William S. Dahlstrom CC: Philip Cochran (philip.cochran@flooranddecor.com) William S. Dahlstrom (214) 953-5932 (Direct Dial) (214) 661-6616 (Direct Fax) wdahlstrom@jw.com Floor and Décor Land Use Plan Amendment Zoning Change and Site Plan Items 6A & 6B CP23-0001 and ZA23-0042 APPLICANT/ OWNER: Philip Cochran of Floor and Décor and Bill Dahlstrom of Jackson Walker LLP on behalf of the owner Greenway-1709 Partners REQUEST: CP23-0001: 1st Reading – Land Use Plan Amendment ZA23-0043: 1st Reading – Zoning Change and Site Plan LOCATION: 2185 E. Southlake Blvd. Aerial Current Zoning Future Land Use Retail Commercial “The Retail Commercial category is a lower- to medium-intensity commercial category providing for neighborhood-type retail shopping facilities and general commercial support activities. It is intended to provide limited local retail and/or office uses which serve neighborhoods in close proximity.” Office Commercial “The Office Commercial category is a commercial category designed and intended for the exclusive use of office and limited office‐related activities.It is established for and will be allocated to those districts best suited for supporting commercial activity of an office character.” Retail Commercial Retail Commercial Purpose and Definition: The Retail Commercial category is a lower- to medium- intensity commercial category providing for neighborhood-type retail shopping facilities and general commercial support activities. It is intended to provide limited local retail and/or office uses which serve neighborhoods in close proximity. It is intended that all uses in this category will be compatible with adjacent single family uses, thereby maintaining the character and integrity of existing neighborhoods. This category is intended to encourage comprehensively planned developments. In areas where the Retail Commercial designation is adjacent to residentially zoned properties or areas with a residential designation on the Land Use Plan, lower intensity activities such as office or office-related uses should be planned adjacent to the residential uses. Other suitable activities are those permitted in the Public Parks/Open Space, Public/Semi-Public, and Office Commercial categories previously discussed. Office Commercial Office Commercial Purpose and Definition: The Office Commercial category is a commercial category designed and intended for the exclusive use of office and limited office‐related activities.It is established for and will be allocated to those districts best suited for supporting commercial activity of an office character. It has been established to encourage and permit general professional and business offices of high quality and appearance, in attractive landscaped surroundings with the types of uses and design exterior appearance so controlled as to be generally compatible with existing and future adjacent and surrounding residential development.Properties with this designation may serve as a transition between established residential neighborhoods, major roadways, and retail development. Other suitable activities are those permitted in the Public Parks/Open Space and Public/Semi‐Public categories previously discussed. Consolidated Future Land Use Plan Amendment Requesting to retain the underlying land use designations and add a site-specific recommendation Proposed Development Regulations Permitted Uses: •B-1 and C-3 uses •Single tenant, owner, or business occupancy exceeding 60,000 s.f. •Warehouse Outside Storage: •Outdoor storage of propane gas for sale or rent as conceptualized on the site plan; masonry screening Building Color Standards: •Use of Regal Red; limited to metal coping, canopies, and signage on the building. No more than 5% of Regal Red will be used per façade. Parking: 141 parking spaces proposed. 318 Req’d by Zoning Ordinance Building Height: •Maximum of 20 feet within 100 feet of residential property; 40 feet elsewhere including architectural features. Tree Canopy Protection: •Preserve 4.34% of existing tree cover. Planting trees that at maturity, will provide 22% greater canopy coverage than the minimum required existing canopy coverage per ordinance. Increasing caliper size of canopy trees. Landscape Plan •Reduce number of tree plantings; increase caliper size of bufferyard trees from 4” to 6”; net result is the same caliper inches of trees will be provided Proposed Development Regulations Traffic On-Site Circulation: •Primary customer, delivery, and site maintenance traffic will be directed to the northernmost driveway •Delivery and maintenance traffic will proceed around the building in a counter- clockwise fashion and exit the southerly drive Traffic Signage: •Inside the “Customer Pick Up” area, there will be signage noting the school drop off and pick up hours and encourage avoiding Village Center Drive during the hours of 7:30 AM – 8:30 AM and 3:00 PM to 4:30 PM •School Zone signage will be placed on the private drive in accordance with TMUTCD standards Proposed Development Regulations Driveways: •Variance to Driveway Ordinance No. 634, as amended, Section 5.2 for stacking depth •Required stacking between Village Center Drive and the proposed south driveway is 100 ft. •Proposed stacking is 41.5 ft. to align with the existing driveway across the common access road Sidewalk: •Escrow funds for the 8+ ft. sidewalk along Village Center Drive Proposed Development Regulations Site Plan Site Plan N Elevations Front and Rear Detail Elevations ~25’ South View Southwest View Rear of Building - Northeast View Rear of Building - Northwest View North View Landscape PlanResidential Tree Preservation Plan Current Street View of Site Southwest View from Kimball Oaks Shopping Center Western View from Village Center Drive Surrounding Property Owner Responses For: 2 Opposed: 1 Undecided: 1 Within 300’ For: 0 Opposed: 31 Undecided: 0 Outside 300’ (As of 4pm Meeting Day) PLANNING AND ZONING COMMISSION ACTION: September 7, 2023; Motion to Deny (6-0). CITY COUNCIL ACTION, 1ST READING: September 19, 2023; Motion to Deny (6-0). Questions? Applicant Presentation S. VILLAGE CENTER DRIVE (60' R.OW.) INSTR. NO. D214263624 LOT 1R, BLOCK 1 CARROLL ISD NO. 4 ADDITION CABINET A, SLIDE 13019 ZONING. CS LUD. PUBLIC/SEMI-PUBLIC LOT 1R, BLOCK 1 GATEWAY CHURCH ADDITION CABINET A, SLIDE 7866 ZONING. CS LUD. OFFICE COMMERCIAL LOT 1, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL LOT 2, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL E. SOUTHLAKE BOULEVARD (F.M. 1709) (Variable Width R.OW.)LOT 1, BLOCK 1KIMBALL CROSSINGCFF. NO. D212098905ZONING. SP1LUD. RETAIL COMMERCIALLOT 1, BLOCK 1ETHAN ALLEN 1709 ADDITIONCAB. A, P, 11456INST. NO. D206305193ZONING. SP1LUD. RETAIL COMMERCIALEX. 24' C.A.E.(CAB. "A", PG. 11456P.R.T.C.T.)EX. 50' BUILDING SETBACKEX. 20' C.A.E. (INST. NO. D206305192) EX. 15' STORM DRAINAGE EASEMENT (CCF NO. D212098905) EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 10' UTILITY EASEMENT (CAB.A. P. 11456 P.R.T.C.T.) EX. 15' UTILITY EASEMENT EX. 15' UTILITY EASEMENT EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. D212098905) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. 214218746) EX. 15' UTILITY EASEMENT (CCF NO. D212098905) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. VARIABLE WIDTH COMMON ACCESS EASEMENT (INST. NO. D206305192) EX. 29' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. 15' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. 214218746) 30' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 30' COMMON ACCESS, UTILITY (INST.AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 15' SANITARY SEWER EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 15' SANITARY SEWER EASEMENT EX. 20' PIPELINE EASEMENT 20' BUFFERYARD TYPE C 10' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 60' R.O.W. DEDICATION N00°10'55"W 592.90'N89°34'50"E237.38'S00°14'24"E 50.00'N89°34'50"E341.93'N00°02'16"W 372.29' S89°34'26"W 30.00' N00°02'16"W 50.00' N89°34'26"E 42.00' S00°02'16"E 967.50'S89°48'13"W589.98'EX. 10' UTILITY EASEMENT (INST. NO. D214263624) FDC 10 9 8 43 8 12 12 6 12 12 11 PROP. DETENTION BASIN 100-YR WSE = 616.65 26' FIRELANEX X X 339,859 SQ. FT. OR 7.802 ACRES (REMAINDER OF A CALLED 11.208 ACRE TRACT) GREENWAY-1709/ELEVEN PARTNERS, L.P. INST. NO D197109628 FLOOR & DECOR 1 STORY 75078 SF. FF = 629.50 9'(TYP.)20' (TYP.) 30' PROP. ENTRY 30' PROP. ENTRY4'30' 25.5' 50'265'8' MASONRY SCREEN WALL 400' RESIDENTIAL ADJACENCY OFFSET R 30' R 15' R 15' R 30' R 56' R 60'R 60' R 30' R 54' R 30' R 15' R 30'R 30' R 25' PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE R 60'5'3" STANDARD CURB 3" MOUNTABLE CURB R 40' R 40' R 30' 3" STANDARD CURB 3" MOUNTABLE CURB BFR 85.2' EXISTING CONCRETE PAVEMENT CONCRETE PAVEMENT CONCRETE PAVEMENT EXISTING CONCRETE PAVEMENT 14.81'20'24'5.5'368.12'37.63'30'15'24'24'30' 26'24'24'24'60'29.6' 24' 44'199.7' 9' 30'13'54'24'20'11.3' 38.39'105.27'10' MASONRY SCREEN WALL ADA PATHWAY PROPOSED DUMPSTER ENCLOSURE W/ 8' MASONRY SCREEN WALL & GATE TW ELE = ±637' PROPOSED RETAINING WALL24' FIRELANE9' (TYP.)20'(TYP.)26' FIRELANE BFR 19' 13' 13' 13' 13'AD C BO 30' PROP. FIRE HYDRANT SEE SHEET 8 FOR PEDESTRIAN ACCESS PLAN PROP. FIRE HYDRANT PROP. FIRE HYDRANT PROP. FIRE HYDRANT PROP. FIRE HYDRANT EX. 175' WIDE DRAINAGE & UTILITY EASEMENT TO BE ABANDONED VOL.12585, PG. 2118 LOADING AREA 40' (TYP.)25.63'13.7' 13.7' 13.7' 13.7' 13.7' 13.7'XX X X XX 5.5' 100' RESIDENTIAL BUILDING HEIGHT SETBACK 100' RESIDENTIAL BUILDING HEIGHT SETBACK 400' RESIDENTIAL ADJACENCY OFFSET 50' BUILDING SETBACK44.1'11.1'15'15' BUILDING SETBACK 15' BUILDING SETBACK 12.1' X X X 30' BUILDING SETBACK PROP. 15' WATER EASEMENT PROP. 15' WATER EASEMENT PROP. 15' WATER EASEMENT PROP. 15' WATER EASEMENT 24'44'PROPOSED TOE WALL 5' CURB CUT W/ FLUME DFW L D N C O N T O U R ( 6 5 L D N) DFW C O N T O U R ( 75 L D N) RESIDENTIAL PROPERTY 5' PROP. GUARDRAIL PROTECTING RISER (INTERNAL WITHIN BUILDING) 32.73' PRELIMINARY PAUL BARTEL 136395 P.E. NO. 8/18/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\ZONING SET\C1-SP-54063.dwg DATE: August 18, 2023, TIME: 7:57 AM, USER: ah4133 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 AUGUST, 2023 CAD PB AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYCITY CASE NO.:ZA23-00427.801 AC., REMAINDER OF TRACTA (11.208 AC.) JOHN FREEMANSURVEY, ABSTRACT NO. 5290 40'80' GRAPHIC SCALE - 1"=40'NLAND USE DESIGNATION ZONING GROSS/NET ACREAGE NUMBER OF PROPOSED LOTS LOT COVERAGE (BUILDING FOOTPRINT) AREA OF OPEN SPACE PERCENTAGE OF OPEN SPACE PRECENTAGE OF IMPERVIOUS COVERAGE BUILDING AREA BUILDING MASONRY PERCENTAGE 75078 S.F. ---- 1 7.80 ACRES GROSS / 6.99 ACRES NET 136330 S.F. 66.26% 24.66% RETAIL, COMMERCIAL, OFFICE, WAREHOUSE* 1 B-1 (REQUIRED) 70.00% MAX. 50.00% MAX. 60000 S.F. MAX. 35 MAX.BUILDING HEIGHT(S) (FT)40' BUSINESS SERVICE PARK SP-1 (PROVIDED) 1 OVERALL SITE PLAN NOTES: ·HEIGHT ALLOWABLE IS BASED ON 4:1 SLOPE FROM POINT O. ·'O' = GROUND ELEVATION @ NEAREST RESIDENTIAL PROPERTY BOUNDARY (626.24) . ENGINEER HALFF ASSOCIATES, INC. 1201 N. BOWSER ROAD RICHARDSON, TX 75081 CONTACT: PAUL BARTEL EMAIL:PBARTEL@HALFF.COM TEL:(214)984-7321 7.80 ACRES LEGEND CONCRETE PAVEMENT X AREA OF IMPERVIOUS COVERAGE 188950 S.F.---- 33.74%15% MIN. ---- **NOTES: 1.REFERENCING PARKING AND TRIP GENERATION STUDY, KIMLEY-HORN. MAY 2023. 2.THE REQUIRED MINIMUM PARKING RATIO FROM THIS STUDY IS BASED ON THE PEAK RECORDED PARKING USE FOR ANY BUILDING/FACILITY RECORDED IN THE STUDY - 0.91/1000 BSF *SINGLE TENANT, OWNER, OR BUSINESS OCCUPANCY EXCEEDING 60,000 SF SUMMARY CHART - BUFFERYARDS (B-1 ZONING) LOCATION / LENGTH OF BASE LINE REQUIRED / PROVIDED LENGTH (FEET) BUFFERYARD WIDTH / TYPE NORTH -REQUIRED 626.31 10 - B PROVIDED 626.31 10 - B EAST -REQUIRED 417.11 10 - B PROVIDED 417.11 20 - B SOUTH -REQUIRED 575.17 10 - B PROVIDED 575.17 20 - B WEST -REQUIRED 532.90 10 - C PROVIDED 532.90 20 - C SITE DATA SUMMARY CHART BENCHMARK LIST POINT #NORTHING (Y)EASTING (X)ELEVATION DESCRIPTION 101 7,027,898.05 2,392,603.80 629.77 SXTP 102 7,028,201.15 2,392,556.93 632.14 SXTP 103 7,028,809.76 2,392,598.36 617.94 SXTP OWNER FLOOR & DECOR 2500 WINDY RIDGE PKWY SE ATLANTA, GA 30339 CONTACT: PHILIP COCHRAN EMAIL:PHILIP.COCHRAN@FLOORANDDECOR.COM TEL:(770)617-4262 BUILDING ENTRANCE/EXIT NUMBER OF STORIES 1 2.5 MAX. ---- OFF STREET LOADING SPACING 2 2 REQUIRED OFF STREET LOADING AREA 4042 S.F.750 S.F. MIN. HEAVY CONCRETE PAVEMENT EXISTING TREE TO REMAIN BUILDING SETBACKS (S-P-1 / B-1 ZONING) N 50' E 15' S 30' W 15' BUILDING HEIGHT SETBACK SOUTH: 20' MAX HEIGHT WITHIN 100' OF RESIDENTIAL PROPERTY (B-1 ZONING) SUMMARY CHART - INTERIOR LANDSCAPE AREA LANDSCAPE AREA AREA IN FRONT OR SIDE REQUIRED 22524 16893 PROVIDED 65182 49959 *NOTE ANY CREDITS USED IN CALCULATIONS: INTERIOR (3) OTHER COMMENTS: OVERLAY RESIDENTIAL ADJACENCY HEIGHT RESTRICTION POINTS HEIGHT ALLOWABLE @ 4:1 THRESHOLD MAX BUILDING ELEVATION @ 40' HEIGHT A 680.74 669.50 B 754.47 669.50 C 768.17 669.50 D 789.04 669.50 USE WAREHOUSE RETAIL STORE 1 / 200 1 / 300 PARKING SPACES --------- S.F.1 SPACE / PER S.F. PARKING PER B-1 ZONING 1/237 (AGGREGATE)318 TOTAL S.F. 1 / 1000 OFFICE GENERAL B-1 PARKING REQUIREMENTS 2656 58815 13607 75078 295 9 14 PROPOSED PARKING 1 / 525 143 REQ. MIN. PARKING (REPORT)**0.91 / 1000**70** 1:1 134567820'-0"FINISHED FLOOR9'-0" A.F.F.B.O. ACCENT BAND/REVEAL16'-0" A.F.F.B.O. ACCENT BAND/REVEAL17'-0" A.F.F.EXTERIOR LIGHTING25'-0" A.F.F.T.O. CONC PANEL47'-6 3/4"368'-1 3/8"54'-0"55'-0"55'-0"55'-0"55'-0"46'-6 3/4"12'-6" A.F.F.B.O. CANOPY36'-9" A.F.F.T.O. STUD WALL26'-7" A.F.F.T.O. TOWER37'-0" A.F.F.T.O. PARAPET26'-4" A.F.F.T.O. CONC. TOWER34'-7 1/2T.O. CONC. PANEL 28'-0" A.F.F.T.O. PARAPET25'-3" A.F.F.T.O. PARAPET19'-8" A.F.FT.O. CONC. PILASTERABCDEF0'-0"FINISHED FLOOR25'-0" A.F.F.T.O. CONC. PANEL9'-0" A.F.F.B.O. ACCENT BAND/REVEAL16'-0" A.F.F.B.O. ACCENT BAND/REVEAL20'-0" A.F.F.EXTERIOR LIGHTING49'-11"238'-2"49'-11"49'-11"49'-11"38'-6"25'-3" A.F.F.T.O. PARAPET 28'-0" A.F.F.T.O. PARAPET19'-8" A.F.FT.O. CONC. PILASTER856342177.10'-0"FINISHED FLOOR20'-0" A.F.F.EXTERIOR LIGHTING55'-0"55'-0"46'-6 3/4"55'-0"46'-6 3/4"368'-1 3/8"55'-0"55'-0" 28'-0" A.F.F.T.O. PARAPET25'-0" A.F.F.T.O. CONC. PANEL25'-3" A.F.F.T.O. PARAPET10'-0" A.F.F. T.O. SCREEN WALL19'-8" A.F.FT.O. CONC. PILASTER1FRONT ELEVATIONSCALE: 1/16" = 1'-0"2REAR ELEVATIONSCALE: 1/16" = 1'-0"3RIGHT ELEVATIONSCALE: 1/16" = 1'-0"4LEFT ELEVATIONSCALE: 1/16" = 1'-0"ABCDEF0'-0"FINISHED FLOOR9'-0" A.F.F.B.O. ACCENT BAND/REVEAL16'-0" A.F.F.B.O. ACCENT BAND/REVEAL20'-0" A.F.F.EXTERIOR LIGHTING38'-6"199'-8"49'-11"49'-11"49'-11"49'-11" 28'-0" A.F.F.T.O. PARAPET25'-0" A.F.F.T.O. CONC. PANEL25'-3" A.F.F.T.O. PARAPETMTL2CS-TTB-1MTL3E-1TB-1TB-2MTLTB-3CS-TMLT3MTL3E-1TB-3TB-1TB-2CS-TTB-2MTL3E-1TB-3TB-1TB-2MTLMTLMTLMTL3E-1CS-TTB-2TB-2TB-3TB-1TB-2TB-3TB-1TB-2TB-3TB-1TB-2TB-3MTL3E-1TB-1TB-2TB-3CS-TP-8P-9CS-TTB-2CS-TTB-2MTL2MTL2MTL2THIN BRICK VENEER PILASTER F&DTYP. 1'-0" DEPTH - DESIGN TOMATCH BUMPOUT ELEMENTTHIN BRICK VENEERBUMPOUT ELEMENTCORNER - 4'-0" x 4'-0"THIN BRICK VENEERBUMPOUT ELEMENTCORNER - 4'-0" x 4'-0"THIN BRICK VENEER BUMPOUTELEMENT CORNER - 4'-0" x 4'-0"THIN BRICK VENEER PILASTER F&D TYP. 1'-0" DEPTHDESIGN TO MATCH BUMPOUT ELEMENTTHIN BRICK VENEER PILASTER F&D TYP. 1'-0" DEPTHDESIGN TO MATCH BUMPOUT ELEMENTTB-3CS-TTB-1TB-2TB-3TB-1TB-2TB-3CS-TMARKMATERIALMANUFACTURERCOLORFINISHNOTESP-8PAINTSHERWIN WILLIAMSSW 7044 AMAZING GRAYSATINRAL COLOR MATCH: RAL 7044, INTERIOR SIDE OF CPUP-9PAINTSHERWIN WILLIAMSSW 7048 URBANE BRONZESATINRAL COLOR MATCH: RAL 7022, INTERIOR SIDE OF CPUP-10PAINTSHERWIN WILLIAMSSW 6868 REAL REDMETAL COPING TO BE FACTORY FINISHED "REGAL RED" TO MATCH P-10 RALCOLOR MATCH: RAL 3020TB-1THIN BRICKGLEN-GERY: MODULARTHIN BRICKCASTELLANA-ON PRECAST PANELS, PILASTER AND PROJECTIONS COLOR TO MATCH P-7 (MAYNOT BE PAINTED)TB-2THIN BRICKGLEN-GERY: MODULARTHIN BRICK800 CLASSIC GRAY SMOOTH-ON PRECAST PANELS, PILASTER AND PROJECTIONS COLOR TO MATCH P-8 (MAYNOT BE PAINTED)TB-3THIN BRICKGLEN-GERY: MODULARTHIN BRICKROMERO-ON PRECAST PANELS, PILASTER AND PROJECTIONS COLOR TO MATCH P-9 (MAYNOT BE PAINTED)CS-TCMULOCAL AVAILABILITYCOLOR TO MATCH P-1THIN CAST STONELOCAL AVAILABILITY 8 X 8 X 16CMUCMULOCAL AVAILABILITYCOLOR TO MATCH P-9SPLIT FACELOCAL AVAILABILITY 8X8X16 (MAY NOT BE PAINTED) - USED AT RECYCLINGENCLOSURE.MTLMETAL COPING, CANOPY, ANDOTHERKYNARREGAL REDSHOP FABRICATED METAL COPING TO BE PREFINISHED "REGAL RED" TOMATCH P-10MTL-2METAL COPING, CANOPY, ANDOTHERKYNARAMAZING GRAYSHOP FABRICATED METAL COPING TO BE PREFINISHED "AMAZING GRAY" TOMATCH P-8MTL-3METAL COPING, CANOPY, ANDOTHERKYNARMEDIUM BRONZESHOP FABRICATED METAL COPING TO BE PREFINISHED "MEDIUM BRONZE" TOMATCH P-9E-1E.I.F.S.DRYVITCOLOR TO MATCH P-9LYMESTONEDRYVIT OUTSULATION PLUS MD SYSTEMPAINT COLOR SCHEDULERTU BEYOND, TYP.RTU BEYOND, TYP.THIN BRICK SCREENWALL BEYOND8' WIDE PRECASTCONCRETE PANELS, TYP.RIGHT ENTRANCE TOWER WITHPRECAST PANELSLEFT ENTRANCE TOWERWITH PRECAST PANELSMETAL CANOPYAT MAIN ENTRYMETAL CANOPYAT CPURECESSED CPUBAYTHIN BRICK VENEER SCREEN WALL8' WIDE PRECASTCONCRETE PANELS, TYP.RTU BEYOND, TYP.METAL COPING, TYP.METAL COPING, TYP.METAL COPING, TYP.TRUCK WELL BEYOND8' WIDE PRECAST CONCRETEPANELS, TYP.8' WIDE PRECAST CONCRETEPANELS, TYP.PRECAST CONCRETE PANEL8-1/2" DEPTHRTU BEYOND, TYP.DOOR SHOWN BEHIND SCREEN WALL - SEE PLANMETAL COPING, TYP.THIN BRICKVENEER BUMPOUTELEMENTTYP. 3'-5" x 4'-0"THIN BRICK VENEER BUMPOUTELEMENTTYP. 3'-5" x 4'-0"PROPANESTORAGE7TYPICAL PRECAST PANELSCALE: 1/4" = 1'-0"0'-0"FINISHED FLOOR16'-0" A.F.F.B.O. BRICK TRANSITION9'-0" A.F.F.B.O. BRICK TRANSITION25'-0" A.F.F.T.O. CONC. PANELS U.N.O.5TYPICAL 4'-0" BUMPOUTSCALE: 1/4" = 1'-0"0'-0"FINISHED FLOOR28'-0" A.F.F.T.O. PARAPET1'-8"16'-0"3'-5"13'-2"3'-5"28'-0 3/4"1'-4 1/2"8"1'-4 1/2"5"TB-1TB-2TB-3MTL3E-1CS-TMTLTB-1TB-3TB-26TYP. 3'5" PILASTERSCALE: 1/4" = 1'-0"3'-5"1'-4 1/2"8"1'-4 1/2"19'-8"MTL2CS-TTB-219'-8" A.F.F.T.O. PILASTER8'-0"0'-0"FINISHED FLOOR10'-4 3/4"FACADE CALCULATIONS8FRONT ELEV. - MATERIAL STUDYSCALE: 1/16" = 1'-0"ELEVATION OVERALLLENGTH (372'-9 3/8")TYPEREQUIREDPROVIDED / MET TOTALTB-1 GLEN GERYMODULAR THIN BRICK -CASTELLANAMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLE83% OR 7,864 SFTB-2 GLEN GERYMODULAR THIN BRICK -800 CLASSIC GRAYSMOOTHMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLETB-3 GLEN GERYMODULAR THIN BRICK -ROMEROMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLECAST STONE MASONRY;MASONRY VENEERMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLE17% OR 1,621 SFTOTAL MASONRY USE: 100% OR 9,485 SF"REGAL RED" ASPROVIDED (RAL 3020)CANOPIES/AWNINGSTOTAL: 1.5% OR 149 SFMETAL COPINGTOTAL: 1.2% OR 123 SFF&D SIGNAGETOTAL: 2.4% OR 230 SFTOTAL: 5% OR 502 SFFACADE CALCULATIONS6RIGHT ELEV. - MATERIAL STUDYSCALE: 1/16" = 1'-0"TYPEREQUIREDPROVIDED / MET TOTALTB-1 GLEN GERYMODULAR THIN BRICK -CASTELLANAMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLE99% OF 5,825 SFTB-2 GLEN GERYMODULAR THIN BRICK -800 CLASSIC GRAYSMOOTHMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLETB-3 GLEN GERYMODULAR THIN BRICK -ROMEROMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLECAST STONE MASONRY;MASONRY VENEERMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLE1% OR 82 SFTOTAL MASONRY USE: 100% OR 5,907 SF"REGAL RED" ASPROVIDED (RAL 3020)CANOPIES/AWNINGSN/AMETAL COPINGTOTAL: 2% OR 139 SFF&D SIGNAGEN/ATOTAL: 2% OR 139 SFFACADE CALCULATIONS7REAR ELEV. - MATERIAL STUDYSCALE: 1/16" = 1'-0"TYPEREQUIREDPROVIDED / MET TOTALTB-1 GLEN GERYMODULAR THIN BRICK -CASTELLANAMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLE99% OR 9,073 SFTB-2 GLEN GERYMODULAR THIN BRICK -800 CLASSIC GRAYSMOOTHMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLETB-3 GLEN GERYMODULAR THIN BRICK -ROMEROMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLECAST STONE MASONRY;MASONRY VENEERMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLE1% OR 105 SFTOTAL MASONRY USE: 100% OR 9,178 SF"REGAL RED" ASPROVIDED (RAL 3020)CANOPIES/AWNINGSN/AMETAL COPINGTOTAL: 2% OR 199 SFF&D SIGNAGEN/ATOTAL: 2% OR 199 SFFACADE CALCULATIONS5LEFT ELEV. - MATERIAL STUDYSCALE: 1/16" = 1'-0"TYPEREQUIREDPROVIDED / MET TOTALTB-1 GLEN GERYMODULAR THIN BRICK -CASTELLANAMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLE98% OR 5,099 SFTB-2 GLEN GERYMODULAR THIN BRICK -800 CLASSIC GRAYSMOOTHMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLETB-3 GLEN GERYMODULAR THIN BRICK -ROMEROMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLECAST STONE MASONRY;MASONRY VENEERMUST BE CONSTRUCTED OFAT LEAST (2) MATERIALS;COMPLIMENT EACH OTHER;AND CONSISTENT IN STYLE2% OR 102 SFTOTAL MASONRY USE: 100% OR 5,201 SF"REGAL RED" ASPROVIDED (RAL 3020)CANOPIES/AWNINGSN/AMETAL COPING2% OR 138 SFF&D SIGNAGE3% OR 145 SFTOTAL: 5% OR 283 SFELEVATION OVERALLLENGTH (373'-1 3/8")ELEVATION OVERALLLENGTH (242'-2")ELEVATION OVERALLLENGTH (207'-8")8PROPANE STORAGE (RIGHT ELEVATION)SCALE: 1/4" = 1'-0"9RECYCLING ENCLOSURE (RIGHT ELEVATION)SCALE: 1/4" = 1'-0"10'-8"8'-0" TYP.10'-8"12'-5"12'-5"REARFRONTSOUTH SIDENORTH SIDEFRONTSOUTH SIDENORTH SIDETHIN BRICK FINISH, TYP.THIN BRICK FINISH, TYP.THIN BRICK FINISH, TYP.CMU SCREEN WALLWITH OPAQUE GATETHIN BRICKFINISH, TYP.CMU SCREEN WALLWITH OPAQUE GATETHIN BRICKFINISH, TYP.5'-0"8'-0" TYP.8'-0"5'-0"EXTERIOR ELEVATIONSA201TMHJH; RRDRAWN:CHECKED:SHEETSEALISSUEGROSS BLDG AREA:JOB NUMBER: ISSUE DATE:STORE NUMBER:PROTOTYPE: 2500 WINDY RIDGEPARKWAY, SE ATLANTA, GA 30339CODE CONSULTANTS, INC.ST. LOUIS, MISSOURI 63146-42352043 WOODLAND PKWY, SUITE 300314-991-2633TMCONSULTING STRUCTURAL ENGINEERSScottsdale, Arizona 85251Phone: (602) 265-4331 Fax: (480) 663-1788A.V. SCHWAN & ASSOCIATES6000 E. Thomas Road, Suite 1Website: www.AVSchwan.comSBLM Architects33 Walt Whitman Road, Suite 300AHuntington Station, NY 11746Telephone 631 683 5588Fax 631 683 559102303675,120 SFT.B.D.T.B.D.2023 Q12185 E Southlake Blvd,Dallas [Southlake], TX 76092Dallas [Southlake], TX STORE #TBD HALFF ASSOCIATES, INC.711 N. CARANCAHUA ST., SUITE 1190CORPUS CHRISTI, TX 78401TELEPHONE: 361-400-0981Eric SeversonQuestions For dlb Call:Phone:dlb associatesCONSULTING ENGINEERS, P.C.(732) 774-20003600 Rt 66, Suite 150 #5981,Neptune, N.J. 07753CITY CASE NO. ZA23-0042ZONING SUBMISSION08/21/23 16910 Dallas Parkway, Ste 216, Dallas, TX 75248 F&D Dallas-Southlake TX 2185 East Southlake Blvd. Dallas{Southlake}, Tx 76092 3D Views July 28, 2023T: 469 544 7770 Web: www.sblm.com Floor & Decor 2500 Windy Ridge Parkway, SE Atlanta, GA, 30339 SITE ORTHOGRAPHIC - FRONT CITY CASE NO. ZA23-0042 August, 21 2023 16910 Dallas Parkway, Ste 216, Dallas, TX 75248 F&D Dallas-Southlake TX 2185 East Southlake Blvd. Dallas{Southlake}, Tx 76092 3D Views July 28, 2023T: 469 544 7770 Web: www.sblm.com Floor & Decor 2500 Windy Ridge Parkway, SE Atlanta, GA, 30339 SOUTH FACE - FRONT CITY CASE NO. ZA23-0042 August, 21 2023 16910 Dallas Parkway, Ste 216, Dallas, TX 75248 F&D Dallas-Southlake TX 2185 East Southlake Blvd. Dallas{Southlake}, Tx 76092 3D Views July 28, 2023T: 469 544 7770 Web: www.sblm.com Floor & Decor 2500 Windy Ridge Parkway, SE Atlanta, GA, 30339 SOUTH WEST CORNER - FRONT CITY CASE NO. ZA23-0042 August, 21 2023 16910 Dallas Parkway, Ste 216, Dallas, TX 75248 F&D Dallas-Southlake TX 2185 East Southlake Blvd. Dallas{Southlake}, Tx 76092 3D Views July 28, 2023T: 469 544 7770 Web: www.sblm.com Floor & Decor 2500 Windy Ridge Parkway, SE Atlanta, GA, 30339 SOUTH EAST CORNER - FRONT CITY CASE NO. ZA23-0042 August, 21 2023 16910 Dallas Parkway, Ste 216, Dallas, TX 75248 F&D Dallas-Southlake TX 2185 East Southlake Blvd. Dallas{Southlake}, Tx 76092 3D Views July 28, 2023T: 469 544 7770 Web: www.sblm.com Floor & Decor 2500 Windy Ridge Parkway, SE Atlanta, GA, 30339 SOUTH EAST CORNER - RIGHT CITY CASE NO. ZA23-0042 August, 21 2023 16910 Dallas Parkway, Ste 216, Dallas, TX 75248 F&D Dallas-Southlake TX 2185 East Southlake Blvd. Dallas{Southlake}, Tx 76092 3D Views July 28, 2023T: 469 544 7770 Web: www.sblm.com Floor & Decor 2500 Windy Ridge Parkway, SE Atlanta, GA, 30339 NORTH EAST CORNER - REAR CITY CASE NO. ZA23-0042 August, 21 2023 16910 Dallas Parkway, Ste 216, Dallas, TX 75248 F&D Dallas-Southlake TX 2185 East Southlake Blvd. Dallas{Southlake}, Tx 76092 3D Views July 28, 2023T: 469 544 7770 Web: www.sblm.com Floor & Decor 2500 Windy Ridge Parkway, SE Atlanta, GA, 30339 NORTH WEST CORNER - REAR CITY CASE NO. ZA23-0042 August, 21 2023 16910 Dallas Parkway, Ste 216, Dallas, TX 75248 F&D Dallas-Southlake TX 2185 East Southlake Blvd. Dallas{Southlake}, Tx 76092 3D Views July 28, 2023T: 469 544 7770 Web: www.sblm.com Floor & Decor 2500 Windy Ridge Parkway, SE Atlanta, GA, 30339 SITE ORTHOGRAPHIC - REAR SCREEN WALLS SHOWN ON LANDSCAPE PLAN EXHIBIT ARE FOR ILLUSTRATIVE PURPOSES ONLY - REF. SITE PLAN FOR ACTUAL WALL LAYOUTS. 28 8 4" (Bufferyards) FILE NAME: \\halff.ad\PZA\AVO\54000s\54063\001\LA\CADD\Sheets\L1.00-54063.dwg DATE: July 27, 2023, TIME: 10:51 AM, USER: ah4341 AVO: 54063SHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 JULY, 2023 PK JRK AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYDATE NAME 2255 R.L.A. NO. 07/27/2023 JAMES R. KINDRED PRELIMINARY FOR INTERIM REVIEW ONLY THESE DOCUMENTS ARE FOR INTERIM REVIEW AND ARE NOT INTENDED FOR REGULATORY APPROVAL,PERMIT,BIDDING OR CONSTRUCTION PURPOSES.THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF:N0 40 8020 Refer to Sitework Specifications for all information needed for landscape work. Notify Landscape Architect or designated representative of any layout discrepancies or any condition which may prohibit the installation as shown. Verify and locate all utilities and site lighting conduits before landscape construction begins. Protection of all utilities is the responsibility of the Contractor. All landscape planting areas illustrated shall be graded smooth with three inches (3") of topsoil and three inches (3") of compost applied and consistently blended (tilled) to a depth of nine inches (9") . If adequate or sufficient topsoil is not available on site, the Contractor shall provide topsoil per the specifications and approved by the Owner. To obtain final grade, excavation may be necessary to accept the required depth of topsoil/compost mix with surface dressing or mulch. All beds shall be crowned to anticipate settlement and ensure drainage without disrupting surrounding planned drainage paths. Any areas disturbed for any reason prior to final acceptance of the project shall be corrected by the Contractor at no additional expense to the Owner. All landscaped areas will be irrigated with an underground automatic system. Quantities shown on these plans are for reference only. Plant spacing is as indicated in the Plant Material List unless otherwise noted. The Contractor has full responsibility to provide coverage in all planting areas as specified. All trees and shrubs shall be installed per planting details. Trees shall be planted at least five feet (5') from any utility line or sidewalk, to the outside of utility easements with a clear ten feet (10') around fire hydrants and twenty feet (20') min. from all irrigation control zone meter boxes, etc. Furthermore, planting within areas of turf shall give priority of location to irrigation. Trees, shall not be planted within five feet (5') of a spray head or ten feet (10') of a rotor. Remaining irrigation components shall respect the location of the illustrated landscape design. Shrubs, regardless of type, shall not be planted within thirty inches (30") of bed perimeters. All plant material shall be maintained in a healthy and growing condition, and must be replaced with similar variety and size if damaged or removed. Container grown plant material is preferred, however ball and burlap material may be substituted as indicated in the plant material list. All planting beds as designated shall be bordered by Owner approved four inch (4") steel edging w/ 316" min. thickness unless bed is bordered by concrete. Steel edging adjacent to decomposed granite beds shall have a 14" min. thickness. Terminate edging flush with paved surface with no sharp corners exposed. A four inch (4") dressing of Shredded hardwood mulch over a 4.1 oz, woven polypropylene, needle-punched fabric or equal weed barrier shall be used in all plant beds and around all trees and within all beds with plants spaced 18" o.c. or greater. Single trees or shrubs shall be mulched to the outside edge of the saucer or landscape island (See planting details). Fertilize all plants at the time of planting with 10-10-10 time release fertilizer. All areas of decomposed granite shall be over a 4.1 oz, woven polypropylene, needle-punched fabric or equal weed barrier of locally available material, installed to a compacted depth of three inches (3") to be flush with the top of curb, paved surface, and/or the top of steel edge. LANDSCAPE PROJECT NOTES EROSION CONTROL: Throughout the project and the maintenance period for turfgrass, it is the Contractor's responsibility to maintain the topsoil in place at specified grades. Topsoil and turfgrass losses due to erosion or any disturbance from construction activity will be replaced by the Contractor until ESTABLISHMENT and ACCEPTANCE is achieved. SOIL PREPARATION: All slopes and areas disturbed by construction, except those occupied by buildings, structures, or paving shall be graded smooth and four (4") inches of topsoil applied. If adequate topsoil is not available onsite, the Contractor shall provide topsoil as approved by the Owner. The area shall be dressed to typical sections and plowed to a depth of five (5") inches. Soil shall be further prepared by the removal of debris, weeds and stones larger than 3/4 inch in diameter. After tillage and cleaning, all areas to receive turf shall be leveled, fine graded, and drug with a weighted spike harrow or float drag. GRASS SOD: Turfgrass sod shall be 100% "Cynodon dactylon" (Common Bermuda grass). Sod shall consist of stolons, leaf blades, rhizomes and roots with a healthy, virile system of dense, thickly matted roots throughout the soil of the sod for a thickness not less than three-quarters (3/4") inch. Sod shall be alive, healthy, vigorous, free of insects, disease, stones, and undesirable foreign materials and grasses. The grass shall have been mowed prior to sod cutting so that the height of grass shall not exceed two (2") inches. Sod shall have been produced on growing beds of clay-loam topsoil. Sod shall not be harvested or planted when its moisture condition is so excessively wet or dry that its survival will be affected. All sod is to be harvested, delivered, and planted within a thirty-six (36) hour period of time. Sod shall be protected from exposure to wind, sun, and freezing. Should installation occur between November and March, sod shall include an over-seed of Annual Rye for a grown-in appearance. IRRIGATION: In the absence of an irrigation system or areas beyond the coverage limits of a permanent irrigation system, Contractor shall water sod temporarily to develop adequate growth and establishment before regular maintenance begins. Turf shall be watered until firmly established. Water shall be furnished by the Contractor with means and methods available to achieve acceptable turf. The water source shall be clean and free of industrial wastes or other substances harmful to the growth of the turf. MAINTENANCE REQUIREMENTS: Vegetation should be inspected regularly to ensure that plant material is established properly and remains healthy. Mowing, trimming and supervision of water applications shall be the responsibility of the Contractor until the Owner or Owner's Representative accepts and assumes regular maintenance. ESTABLISHMENT AND ACCEPTANCE: All disturbed areas recieving sod shall receive topsoil as specified and be adequately established with turf such that any absence of water will not kill the turf, but promote a state of turf dormancy, until the next rainfall event. Regardless of unseasonable climatic conditions or other adverse conditions affecting planting operations and the growth of the turf grass, it shall be the sole responsibility of the Contractor to establish a uniform stand of grass. UNIFORM STAND OF GRASS is defined as minimum 80% coverage per square foot (no bare areas). Contractor to make a written request for inspection to Owner or Owner's representative a minimum of 5 days prior to the anticipated inspection date. SOD PROJECT NOTES 8" 3" D D D SHRUBS AS SPECIFIED NOTE: D = DIMENSION OF PLANT SPACING (SHRUB AND GROUNDCOVER AS INDICATED ON DRAWINGS) AMENDED SOIL UNDISTURBED SUBGRADE 4" LAYER OF MULCH OVER WEED BLOCK BACKFILL TO REMOVE ALL VOIDS BREAK THROUGH AND REMOVE ANY EXISTING "HARDPAN" AS NECESSARY TO PROVIDE GOOD PERCOLATION AND POSITIVE DRAINAGE 3" LAYER OF DECOMPOSED GRANITE OVER WEED BLOCK PIT PLANTED SHRUB 4" STEEL EDGE - AS SHOWN IN LANDSCAPE PLAN (REF. LANDSCAPE PROJECT NOTES) SHRUB / GROUNDCOVER PLANTING & SPACING N.T.S. IF SHRUB IS BALL AND BURLAP, THEN REMOVE BURLAP AND ROPE FROM TOP 1/3 OF ROOTBALL NOTE: 1.SEE LANDSCAPE NOTES FOR THE TYPE OF WEED BLOCK AND MULCH MATERIAL TO USE. 2.OMIT WEED BLOCK WHEN PLANT SPACING IS 18" O.C. OR LESS SHRUB DISTANCE FROM EDGE OF BED N.T.S. 4' MIN. 2.5' MIN. 2.5' MIN. SPECIFIED BED BORDER NOTE: SEE LANDSCAPE NOTES AND SHRUB PLANTING AND SPACING DETAIL FOR INSTALLATION. 2' MIN. BACK OF CURB SPECIFIED BED BORDER EDGE OF SIDEWALK OR AS OTHERWISE SPECIFIED ON PLAN 2.5' MIN. OR AS OTHERWISE SPECIFIED ON PLAN 2"x2" STAKE (UNTREATED) 2"x2" UNTREATED CROSS MEMBER TO A LENGTH TO SPAN OPEN PIT REMOVE BURLAP & ROPE FROM TOP 1/3 OF THE BALL UNDISTURBED SUBSOIL BACKFILL MIX 2"x2" UNTREATED STAKE TO A DEPTH WITHIN FIRM SUBSOIL TO HOLD TREE IN PLACE 2"x2" UNTREATED CROSS MEMBER TO A LENGTH TO SPAN OPEN PIT 2" MULCH CREATING A 4" DEEP SAUCER ARBORTIE ROOT BALL DEPTH 6" DEPTH HEIGHT VARIES (SEE PLANT LIST) 1' TREE PLANTING N.T.S. NOTE: 1. ARBORTIE SHOULD ONLY BE USED AS A REMEDIAL MEANS TO PLUMB A TREE WHEN THE PRIMARY BELOW GRADE STAKING CAN NO LONGER BE ADJUSTED EFFECTIVELY AND CONDITIONS ARE WARRANTED BY THE LANDSCAPE ARCHITECT. 2. SEE LANDSCAPE NOTES FOR THE TYPE OF WEED BLOCK AND MULCH MATERIAL TO USE. LIMITS OF ROOT BALL/ INNER EDGE OF SAUCER LIMITS OF HOLE OUTER EDGE OF SAUCER PLAN VIEW PLACE TOP OF ROOT BALL MIN. 1" - MAX. 2" ABOVE GRADE APPLY DOWNWARD PRESSURE TO CROSS MEMBER AND CONNECT TO STAKE WITH 3" WOOD SCREW ARBORTIE STRAP 3/4" WHITE OR GRAY PVC SLEEVE 24" LONG TREE TRUNK ARBORTIE (PER MANUFACTURER INSTALLATION INSTRUCTIONS) LIMITS OF ROOT BALL LIMITS OF HOLE NOTE: SEE LANDSCAPE NOTES FOR THE TYPE OF WEED BLOCK AND MULCH MATERIAL TO USE. PLAN VIEW TREE TRUNK ROOT BALL DEPTH 6" DEPTH HEIGHT VARIES (SEE PLANT LIST) 1' ARBORTIE WHITE FLAGGING 1/3 (120°) REMOVE BURLAP & ROPE FROM TOP 1/3 OF THE BALL UNDISTURBED SUBSOIL BACKFILL MIX 6' STEEL TEE POST (3 @ 120°) 4" MULCH OVER WEED BLOCK CREATING A 4 INCH DEEP SAUCER WHITE FLAGGING (TYP.) (3) TEE POST TREE PLANTING ON A SLOPE N.T.S. EXISTING GROUND CUT BACK SLOPE TO PROVIDE A FLAT SURFACE FOR PLANTING OUTER EDGE OF SAUCER (*) SEE SHRUB PLANTING DETAIL FOR DIMENSIONS. REFERENCE PLANT MATERIAL LIST FOR PLANT TYPES AND LOCATIONS. TERMINUS OF 60° PARKING ROW GENERAL STEEL EDGE ALIGNMENT EXAMPLES N.T.S. CURB (TYP.) (*) SHRUB (REF. DETAIL) STEEL EDGE TURF CURB (TYP.) (*) SHRUB (REF. DETAIL) STEEL EDGE CURB INLET CURB (TYP.) (*) SHRUB (REF. DETAIL) STEEL EDGE CURB INLET CURB (TYP.) (*) SHRUB (REF. DETAIL) STEEL EDGE CURB (TYP.) (*) SHRUB (REF. DETAIL) STEEL EDGE TURFTURFTURF TURF ALTERNATE TERMINUS OF 60° PARKING ROW TERMINUS OF 90° PARKING ROW 60° PARKING WITH CURB INLET ALTERNATE 60° PARKING WITH CURB INLET STEEL EDGE CURB OR SIDEWALK CUT EXPOSED EDGE AT AN ANGLE 1/2" BELOW TOP OF CURB OR SIDEWALK 12" STEEL EDGE STAKE, TYP. 12" STEEL SPLICING EDGING STAKE (SEE NOTE #3 BELOW) STEEL EDGE TURF SOD OR SEED 1-1/2" BELOW TOP OF STEEL TOPSOIL 12" STEEL EDGE STAKE SHREDDED BARK MULCH SIDE VIEW FRONT VIEW TOP VIEW TURF CURB OR SIDEWALK BEND STEEL EDGE AT A 90° ANGLE AND STAKE IN PLACE WITH ANGLE CUT OF EXPOSED CORNER AS SHOWN BELOW TERMINUS OPTION 'A' TERMINUS OPTION 'B' STEEL EDGE TERMINATION N.T.S. 1.INSTALL STEEL EDGING TO UTILIZE FULL SECTIONS UNLESS CONTROLLED OTHERWISE WITH PLAN SHEET DIMENSIONS. 2.CUT STEEL EDGING AT AN ANGLE TO ACHIEVE A FINISHED STEEL EDGE HEIGHT OF 1/2" BELOW THE TOP OF ADJACENT HARDSCAPE. 3.IF STAKING IS NOT AVAILABLE WITHIN 12" OF THE EDGING TERMINATION, INSTALL A SPLICING EDGING STAKE WITHIN 6" OF THE TERMINATING EDGE AS SHOWN WITH OPTION 'B' 4.WHERE POSSIBLE, EDGE TERMINATION SHALL BE INSTALLED AS SHOWN IN TERMINUS OPTION 'A'. NOTES: LANDSCAPE DETAILS AND NOTES L1.02 625626627628628 629 630 629 631 628 625 626 627 628621621622623 625626627628624RIDGERIDGE RIDGE RIDGE RIDGE RIDGE RIDGE 625 622623624 626627 6 2 5 6 2 1 6 2 2 6 2 3 6 2 4 6 2 6 6 2 7 6 2 8 6 2 7 627 620621622623624620 621622623624615616617618617618619GRADE BREAK GRADE BREAK GRADE BREAK GRADE BREAK 627 627 6256246246256 2 5626 RIDGE626 EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINE EX. 8" WATER LINEEX. 6" WATER LINEEX. 6" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINEEX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8'x4' RCBC EX. 18" RCPEX. 36" RCP EX. 18" RCPEX. 42" RCP EX. 24" HDPE EX. 24" HDPEEX. 7'x5' RCBCEX. 7'x5' RCBC EX. 30" RCP EX. 18" RCPEX. 7'x5' RCBCEX. 7'x5' RCBC EX. 18" RCP EX. 27 " RCP EX. 7'x5' RCBC EX. 30" RCP EX. 21" RCPE X . 5 4 " RC P EX. 36" RCPEX. 30" RCP EX. 18" RCPEX. 42" RCPEX. U.G.E.EX. U.G.E.EX. U.G.E. EX. U.G.E.EX. U.G.E.EX. 42" RCPEX. 8" WATER LINE339,859 SQ. FT. OR 7.802 ACRES (REMAINDER OF A CALLED 11.208 ACRE TRACT) GREENWAY-1709/ELEVEN PARTNERS, L.P. INST. NO D197109628 30' FDC FLOOR & DECOR1 STORY75,078 SF.FF = 629.5010 9 8 43 8 12 12 6 12 12 11 PROP. DETENTION BASIN 100-YR WSE = 616.65 LOT 1R, BLOCK 1 CARROLL ISD NO. 4 ADDITION CABINET A, SLIDE 13019 ZONING. CS LUD. PUBLIC/SEMI-PUBLIC S. VILLAGE CENTER DRIVE (60' R.OW.) LOT 1R, BLOCK 1 GATEWAY CHURCH ADDITION CABINET A, SLIDE 7866 ZONING. CS LUD. OFFICE COMMERCIAL 8' MASONRY FENCE PROPERTY LINE PROPERTY LINE PROPERTY LINE PROPERTY LINE EXISTING CONCRETE PAVEMENT CONCRETE PAVEMENT EXISTING CONCRETE PAVEMENT 60' R.O.W. DEDICATION 30' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT LOT 1, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL PRELIMINARY PAUL BARTEL 136395 P.E. NO. 8/17/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\ZONING SET\C8-TCP-54063.dwg DATE: August 17, 2023, TIME: 4:38 PM, USER: ah4133 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 AUGUST, 2023 CAD PB AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYCITY CASE NO.:ZA23-00427.801 AC., REMAINDER OF TRACTA (11.208 AC.) JOHN FREEMANSURVEY, ABSTRACT NO. 529N9 TREE CONSERVATION PLAN TREE CONSERVATION LEGEND EXISTING TREE TO BE REMOVED EXISTING TREE TO BE REMAIN OFF-SITE TREE TO REMAIN TREE CANOPY AREA EXISTING TREE TO POTENTIALLY REMAIN TREE SURVEY OFFSITE TABLE Tag ID Common Name Scientific Name DBH (in)Trunks Condition 1 Live oak Quercus virginiana 8.5 2X Good 2 Lacebark elm Ulmus parvifolia 11 3X Good 3 Lacebark elm Ulmus parvifolia 6.5 2X Good 4 Sugar hackberry Celtis laevigata 6 2X Good 5 Sugar hackberry Celtis laevigata 8 2X Good 6 Live oak Quercus virginiana 6 2X Good 7 Lacebark elm Ulmus parvifolia 11 2X Good 8 Pecan Carya illinoinensis 19 3X Good 9 Sugar hackberry Celtis laevigata 21.5 5X Good 10 Sugar hackberry Celtis laevigata 12 3X Good 11 Sugar hackberry Celtis laevigata 23 5X Good 12 Pecan Carya illinoinensis 18 Good 13 Sugar hackberry Celtis laevigata 9 Good 14 Pecan Carya illinoinensis 17 2X Good 15 Pecan Carya illinoinensis 6.5 Good 16 American elm Ulmus americana 6.5 Good 17 Red mulberry Morus rubra 6 4X Good 18 Pecan Carya illinoinensis 6 Good 19 American elm Ulmus americana 11.5 2X Good 20 American elm Ulmus americana 11 Good 21 Sugar hackberry Celtis laevigata 12 3X Good 22 American elm Ulmus americana 17 2X Good 23 Sugar hackberry Celtis laevigata 7 Good 24 American elm Ulmus americana 8.5 Good 25 Eastern cottonwood Populus deltoides 11 Good 26 Eastern cottonwood Populus deltoides 22 Good 27 Sugar hackberry Celtis laevigata 13.5 Good 28 Pecan Carya illinoinensis 7 Good 29 Sugar hackberry Celtis laevigata 14 Good 30 Lacebark elm Ulmus parvifolia 13.5 3X Good 31 Bradford pear Pyrus calleryana 7.5 2X Good 32 Lacebark elm Ulmus parvifolia 7.5 Good 33 Pecan Carya illinoinensis 13.5 2X Good 34 Pecan Carya illinoinensis 16.5 3X Good 35 Pecan Carya illinoinensis 12.5 Good 36 Sugar hackberry Celtis laevigata 9.5 Good 37 Sugar hackberry Celtis laevigata 11 2X Good 38 Sugar hackberry Celtis laevigata 7.5 2X Good 39 Sugar hackberry Celtis laevigata 10.5 Good 40 Eastern red cedar Juniperus virginiana 6.5 Good 42 Sugar hackberry Celtis laevigata 8 Good 43 Sugar hackberry Celtis laevigata 7.5 Good 44 Sugar hackberry Celtis laevigata 9.5 2X Good 45 Sugar hackberry Celtis laevigata 9 Good 46 Sugar hackberry Celtis laevigata 7 2X Good 47 Hercules club Zanthoxylum clava-herculis 6 Good 48 Sugar hackberry Celtis laevigata 11 2X Good 49 Sugar hackberry Celtis laevigata 7 Good 50 Eastern cottonwood Populus deltoides 16.5 Good 51 Eastern cottonwood Populus deltoides 22.5 Good 52 Black willow Salix nigra 33 Good 53 Sugar hackberry Celtis laevigata 7 Good 54 Lacebark elm Ulmus parvifolia 13.5 4X Good 55 Lacebark elm Ulmus parvifolia 8.5 2X Good 56 Lacebark elm Ulmus parvifolia 8 Good 57 Lacebark elm Ulmus parvifolia 7.5 2X Good 66 American elm Ulmus americana 17.5 6X Good 214 American elm Ulmus americana 12.5 3X Good 215 American elm Ulmus americana 10 Good 216 American elm Ulmus americana 7 Good 217 American elm Ulmus americana 10 Good 218 American elm Ulmus americana 13.5 3X Good 219 American elm Ulmus americana 7 Good 237 American elm Ulmus americana 7 Good 238 American elm Ulmus americana 6.5 Good 239 American elm Ulmus americana 7.5 Good 242 Pecan Carya illinoinensis 24.5 2X Good 243 Cedar elm Ulmus crassifolia 5 Good 244 Cedar elm Ulmus crassifolia 5 Good 245 Cedar elm Ulmus crassifolia 5 Good 246 Cedar elm Ulmus crassifolia 4.5 Good 247 Cedar elm Ulmus crassifolia 5.5 Good 248 Pecan Carya illinoinensis 22.5 2X Good 249 Cedar elm Ulmus crassifolia 5.5 Good 250 Live oak Quercus virginiana 5.5 Good 251 Live oak Quercus virginiana 5.5 Good 252 Live oak Quercus virginiana 5.5 Good 253 Willow oak Quercus phellos 5.5 Good 255 Live oak Quercus virginiana 6 Good 256 Eastern red cedar Juniperus virginiana 7 2X Good 257 Lacebark elm Ulmus parvifolia 8.5 5X Good 259 Sugar hackberry Celtis laevigata 13.5 Good 260 Sugar hackberry Celtis laevigata 9 2X Good 261 Sugar hackberry Celtis laevigata 10 Good 262 Sugar hackberry Celtis laevigata 7 Good 263 Sugar hackberry Celtis laevigata 11 2X Good 264 Sugar hackberry Celtis laevigata 13 6X Good 265 American elm Ulmus americana 15.5 Good 266 Sugar hackberry Celtis laevigata 9 Good 267 Sugar hackberry Celtis laevigata 7 Good 268 Sugar hackberry Celtis laevigata 10.5 Good 269 Sugar hackberry Celtis laevigata 11.5 3X Good 270 Sugar hackberry Celtis laevigata 13 2X Good 271 Sugar hackberry Celtis laevigata 12 2X Good 274 Sugar hackberry Celtis laevigata 10 3X Good 275 Sugar hackberry Celtis laevigata 11 3X Good 276 Sugar hackberry Celtis laevigata 6 2X Good 277 Sugar hackberry Celtis laevigata 14 Good 278 Sugar hackberry Celtis laevigata 9 Good 279 Sugar hackberry Celtis laevigata 15 2X Good 280 Sugar hackberry Celtis laevigata 25 7X Good 281 Sugar hackberry Celtis laevigata 20 6X Good 282 Sugar hackberry Celtis laevigata 9.5 Good 283 Sugar hackberry Celtis laevigata 9.5 3X Good 284 Sugar hackberry Celtis laevigata 12.5 5X Good 285 Sugar hackberry Celtis laevigata 9.5 3X Good 286 Sugar hackberry Celtis laevigata 6.5 Good 287 Sugar hackberry Celtis laevigata 16.5 5X Good 288 Chinese pistache Pistacia chinensis 10.5 2X Good 289 Sugar hackberry Celtis laevigata 9 Good 291 Sugar hackberry Celtis laevigata 6.5 2X Good TP LIMITS OF TREE PROTECTION (PER METHOD AS APPROPIATE) (PER CITY OF SOUTHLAKE STANDARDS TREE TABULATIONS GROSS SITE AREA 293,050 SF EXISTING TREE CANOPY AREA: % OF SITE AREA: TOTAL DBH: 116,165 SF 39.64% 2214 IN EXISTING TREE CANOPY PROPOSED TO BE REMOVED AREA: % OF TREE CANOPY AREA: TOTAL DBH: 111,131 SF 95.66% 2109 IN EXISTING TREE CANOPY PROPOSED TO REMAIN AREA: % OF TREE CANOPY AREA: TOTAL DBH: 5,041 SF 4.34% 105 IN NOTE: TREE CANOPY CALCULATION ARE APPROXIMATE BASED ON TREE LOCATION FROM TREE SURVEY COMBINED WITH AERIAL IMAGERY NOTE : TREE CANOPY CALCULATION EXCLUDES ALL RIGHT OF WAY AND OFF-SITE TREE CANOPY/AREA FROM NEIGHBORING PROPERTIES TREE SURVEY REMAINING TABLE Tag ID Common Name Scientific Name DBH (in)Trunks Condition 58 Sugar hackberry Celtis laevigata 6 Good 65 Lacebark elm Ulmus parvifolia 25.5 6X Good 272 Pecan Carya illinoinensis 16.5 2X Good 273 American elm Ulmus americana 39.5 3X Good 290 American elm Ulmus americana 17.5 Good TREE SURVEY DEMOLITION TABLE Tag ID Common Name Scientific Name DBH (in)Trunks Condition 41 Pecan Carya illinoinensis 22.5 Good 59 Pecan Carya illinoinensis 18.5 2X Good 60 Pecan Carya illinoinensis 18.5 2X Good 61 Pecan Carya illinoinensis 21 4X Good 62 Pecan Carya illinoinensis 16 2X Good 63 Pecan Carya illinoinensis 18.5 2X Good 64 Pecan Carya illinoinensis 24 2X Good 67 Pecan Carya illinoinensis 19.5 3X Good 68 American elm Ulmus americana 27 5X Good 69 Sugar hackberry Celtis laevigata 15.5 3X Good 70 Black willow Salix nigra 9.5 2X Good 71 Black willow Salix nigra 7.5 3X Good 72 Black willow Salix nigra 6.5 2X Good 73 Black willow Salix nigra 7.5 2X Good 74 Black willow Salix nigra 7.5 Good 75 Black willow Salix nigra 8.5 2X Good 76 Black willow Salix nigra 10.5 3X Good 77 Black willow Salix nigra 9.5 2X Good 78 Black willow Salix nigra 9 2X Good 79 Eastern red cedar Juniperus virginiana 15.5 Good 80 Eastern red cedar Juniperus virginiana 12.5 Good 81 Sugar hackberry Celtis laevigata 12 Good 82 Black willow Salix nigra 20 2X Good 83 Sugar hackberry Celtis laevigata 12.5 Good 84 Live oak Quercus virginiana 17 5X Good 85 Cedar elm Ulmus crassifolia 8 Good 86 Pecan Carya illinoinensis 17 Good 87 Pecan Carya illinoinensis 28 5X Good 88 Pecan Carya illinoinensis 11 Good 89 Pecan Carya illinoinensis 13.5 Good 90 Pecan Carya illinoinensis 21 2X Good 93 Live oak Quercus virginiana 6 Good 94 Live oak Quercus virginiana 8.5 4X Good 95 Eastern red cedar Juniperus virginiana 6.5 Good 96 Live oak Quercus virginiana 8.5 2X Good 97 Eastern red cedar Juniperus virginiana 6 Good 98 Eastern red cedar Juniperus virginiana 7.5 Good 99 Water oak Quercus nigra 6 Good 100 Eastern red cedar Juniperus virginiana 7.5 Good 101 Eastern red cedar Juniperus virginiana 7 Good 102 Sugar hackberry Celtis laevigata 7.5 Good 103 Pecan Carya illinoinensis 8.5 Good 104 Sugar hackberry Celtis laevigata 7 Good 105 American elm Ulmus americana 12 Good 106 Pecan Carya illinoinensis 8.5 Good 107 Pecan Carya illinoinensis 8 Good 108 American elm Ulmus americana 6 Good 109 Pecan Carya illinoinensis 11.5 Good 110 American elm Ulmus americana 11.5 Good 111 Eastern red cedar Juniperus virginiana 13 3X Good 112 American elm Ulmus americana 26.5 2X Good 113 Sugar hackberry Celtis laevigata 13 Good 114 American elm Ulmus americana 16.5 Good 115 American elm Ulmus americana 21.5 4X Good 116 American elm Ulmus americana 28 2X Good 117 Sugar hackberry Celtis laevigata 7.5 2X Good 118 Pecan Carya illinoinensis 13 2X Good 119 Pecan Carya illinoinensis 7 Good 120 Pecan Carya illinoinensis 13.5 2X Good 121 Pecan Carya illinoinensis 15 2X Good 122 Pecan Carya illinoinensis 7 Good 123 American elm Ulmus americana 14.5 2X Good 124 Sugar hackberry Celtis laevigata 6.5 Good 125 Pecan Carya illinoinensis 12 Good 126 Sugar hackberry Celtis laevigata 16.5 Good 127 American elm Ulmus americana 8.5 2X Good 128 American elm Ulmus americana 21.5 3X Good 129 Blackjack oak Quercus marilandica 6.5 Good 130 Sugar hackberry Celtis laevigata 12.5 2X Good 131 Bradford pear Pyrus calleryana 9 Good 132 American elm Ulmus americana 13.5 Good 133 American elm Ulmus americana 41 3X Good 134 Sugar hackberry Celtis laevigata 8.5 Good 135 Pecan Carya illinoinensis 7 Good 136 Blackjack oak Quercus marilandica 6 Good 137 Pecan Carya illinoinensis 16.5 Good 138 Pecan Carya illinoinensis 7 Good 139 Pecan Carya illinoinensis 12.5 Good 140 Pecan Carya illinoinensis 8.5 Good 141 Pecan Carya illinoinensis 6.5 Good 142 American elm Ulmus americana 10.5 3X Good 143 Sugar hackberry Celtis laevigata 6.5 2X Good 144 American elm Ulmus americana 14.5 2X Good 145 Sugar hackberry Celtis laevigata 11.5 6X Good 146 Cedar elm Ulmus crassifolia 12.5 2X Good 147 Sugar hackberry Celtis laevigata 10 Good 148 Cedar elm Ulmus crassifolia 6.5 Good 149 American elm Ulmus americana 6.5 3X Good 150 Mesquite Prosopis glandulosa 33 10X Good 151 American elm Ulmus americana 9.5 2X Good 152 American elm Ulmus americana 8.5 Good 153 American elm Ulmus americana 12.5 Good 154 American elm Ulmus americana 6 2X Good 155 Pecan Carya illinoinensis 6 Good 156 American elm Ulmus americana 7.5 Good 157 American elm Ulmus americana 6 Good 158 Gum bumelia Sideroxylon lanuginosum 6 2X Good 159 Pecan Carya illinoinensis 7 Good 160 Sugar hackberry Celtis laevigata 8 Good 161 American elm Ulmus americana 16 Good 162 American elm Ulmus americana 10 3X Good 163 Sugar hackberry Celtis laevigata 18 3X Good 164 American elm Ulmus americana 6 Good 165 Osage orange Maclura pomifera 13 3X Good 166 Pecan Carya illinoinensis 9.5 Good 167 American elm Ulmus americana 11 Good 168 Bradford pear Pyrus calleryana 11.5 3X Good 169 Live oak Quercus virginiana 14.5 2X Good 170 Eastern cottonwood Populus deltoides 7.5 Good 171 Eastern cottonwood Populus deltoides 9 2X Good 172 Eastern cottonwood Populus deltoides 9 3X Good 173 Pecan Carya illinoinensis 8.5 Good 174 Sugar hackberry Celtis laevigata 10 3X Good 175 American elm Ulmus americana 14.5 2X Good 176 Pecan Carya illinoinensis 6 Good 177 Bradford pear Pyrus calleryana 13 2X Good 178 American elm Ulmus americana 7 Good 179 Live oak Quercus virginiana 6 2X Good 180 American elm Ulmus americana 7 2X Good 181 Sugar hackberry Celtis laevigata 17.5 3X Dead 182 Pecan Carya illinoinensis 7 Good 183 Pecan Carya illinoinensis 15 Good 184 Sugar hackberry Celtis laevigata 9 Good 185 Eastern red cedar Juniperus virginiana 6 Good 186 Eastern red cedar Juniperus virginiana 8 Good 187 Eastern red cedar Juniperus virginiana 7 Good 188 Sugar hackberry Celtis laevigata 12 3X Good 189 Live oak Quercus virginiana 7 Good 190 American elm Ulmus americana 7 Good 191 Post oak Quercus stellata 6.5 Good 192 American elm Ulmus americana 6.5 Good 193 Hercules club Zanthoxylum clava-herculis 6 Good 194 Hercules club Zanthoxylum clava-herculis 6.5 Good 195 American elm Ulmus americana 20 Good 196 Sugar hackberry Celtis laevigata 10 Good 197 Pecan Carya illinoinensis 6.5 Good 198 Pecan Carya illinoinensis 6 Good 199 Live oak Quercus virginiana 7 Good 200 Live oak Quercus virginiana 7 2X Good 201 Live oak Quercus virginiana 7 Good 202 Live oak Quercus virginiana 9 Good 203 Pecan Carya illinoinensis 10 Good 204 American elm Ulmus americana 44.5 4X Good 205 Eastern red cedar Juniperus virginiana 15 Good 206 Bradford pear Pyrus calleryana 8 2X Good 207 Sugar hackberry Celtis laevigata 8 2X Good 208 Sugar hackberry Celtis laevigata 6 3X Good 209 American elm Ulmus americana 6 Good 210 American elm Ulmus americana 8 2X Good 211 American elm Ulmus americana 8 Good 212 American elm Ulmus americana 9.5 2X Good 213 American elm Ulmus americana 9 Good 220 American elm Ulmus americana 15.5 3X Good 221 American elm Ulmus americana 10 Good 222 American elm Ulmus americana 6 Good 223 Sugar hackberry Celtis laevigata 13.5 4X Good 224 American elm Ulmus americana 7.5 Good 225 American elm Ulmus americana 18 3X Good 226 American elm Ulmus americana 10 Good 227 American elm Ulmus americana 28 Good 228 American elm Ulmus americana 16.6 Good 229 Pecan Carya illinoinensis 10 2X Good 230 Pecan Carya illinoinensis 21.5 2X Good 231 Pecan Carya illinoinensis 25.5 2X Good 232 Eastern cottonwood Populus deltoides 7.5 Good 233 Live oak Quercus virginiana 12.5 3X Good 234 Hercules club Zanthoxylum clava-herculis 8 4X Good 235 American elm Ulmus americana 7.5 Good 236 American elm Ulmus americana 12.5 3X Good 240 American elm Ulmus americana 7 Good 241 American elm Ulmus americana 7 Good 254 American elm Ulmus americana 8.5 3X Good 258 Lacebark elm Ulmus parvifolia 13 5X Good 292 Eastern cottonwood Populus deltoides 8 2X Good 293 Eastern cottonwood Populus deltoides 6.5 Good 294 Eastern cottonwood Populus deltoides 9 2X Good 295 Eastern cottonwood Populus deltoides 7.5 Good 296 Eastern cottonwood Populus deltoides 6.5 2X Good 297 Eastern cottonwood Populus deltoides 7 2X Good 298 Eastern cottonwood Populus deltoides 7.5 Good 299 Eastern cottonwood Populus deltoides 7 Good 91 Pecan Carya illinoinensis 19 Good 92 Pecan Carya illinoinensis 19.5 3X Good 0 50'100' GRAPHIC SCALE - 1"=50' BENCHMARK LIST POINT #NORTHING (Y)EASTING (X)ELEVATION DESCRIPTION 101 7,027,898.05 2,392,603.80 629.77 SXTP 102 7,028,201.15 2,392,556.93 632.14 SXTP 103 7,028,809.76 2,392,598.36 617.94 SXTP OWNER FLOOR & DECOR 2500 WINDY RIDGE PKWY SE ATLANTA, GA 30339 CONTACT: PHILIP COCHRAN EMAIL:PHILIP.COCHRAN@FLOORANDDECOR.COM TEL:(770)617-4262 ENGINEER HALFF ASSOCIATES, INC. 1201 N. BOWSER ROAD RICHARDSON, TX 75081 CONTACT: PAUL BARTEL EMAIL:PBARTEL@HALFF.COM TEL:(214)984-7321 S. VILLAGE CENTER DRIVE (60' R.OW.) INSTR. NO. D214263624 LOT 1R, BLOCK 1 CARROLL ISD NO. 4 ADDITION CABINET A, SLIDE 13019 ZONING. CS LUD. PUBLIC/SEMI-PUBLIC LOT 1R, BLOCK 1 GATEWAY CHURCH ADDITION CABINET A, SLIDE 7866 ZONING. CS LUD. OFFICE COMMERCIAL LOT 1, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL LOT 2, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL E. SOUTHLAKE BOULEVARD (F.M. 1709) (Variable Width R.OW.)LOT 1, BLOCK 1KIMBALL CROSSINGCFF. NO. D212098905ZONING. SP1LUD. RETAIL COMMERCIALLOT 1, BLOCK 1ETHAN ALLEN 1709 ADDITIONCAB. A, P, 11456INST. NO. D206305193ZONING. SP1LUD. RETAIL COMMERCIALEX. 24' C.A.E.(CAB. "A", PG. 11456P.R.T.C.T.)EX. 50' BUILDING SETBACKEX. 20' C.A.E. (INST. NO. D206305192) EX. 15' STORM DRAINAGE EASEMENT (CCF NO. D212098905) EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 10' UTILITY EASEMENT (CAB.A. P. 11456 P.R.T.C.T.) EX. 15' UTILITY EASEMENT EX. 15' UTILITY EASEMENT EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. D212098905) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. 214218746) EX. 15' UTILITY EASEMENT (CCF NO. D212098905) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. VARIABLE WIDTH COMMON ACCESS EASEMENT (INST. NO. D206305192) EX. 29' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. 15' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. 214218746) 30' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 30' COMMON ACCESS, UTILITY (INST.AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 15' SANITARY SEWER EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 15' SANITARY SEWER EASEMENT EX. 20' PIPELINE EASEMENT 20' BUFFERYARD TYPE C 10' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 60' R.O.W. DEDICATION N00°10'55"W 592.90'N89°34'50"E237.38'S00°14'24"E 50.00'N89°34'50"E341.93'N00°02'16"W 372.29' S89°34'26"W 30.00' N00°02'16"W 50.00' N89°34'26"E 42.00' S00°02'16"E 967.50'S89°48'13"W589.98'EX. 10' UTILITY EASEMENT (INST. NO. D214263624) FDC 10 9 8 43 8 12 12 6 12 12 11 PROP. DETENTION BASIN 100-YR WSE = 616.65 339,859 SQ. FT. OR 7.802 ACRES (REMAINDER OF A CALLED 11.208 ACRE TRACT) GREENWAY-1709/ELEVEN PARTNERS, L.P. INST. NO D197109628 FLOOR & DECOR 1 STORY 75078 SF. FF = 629.50 PROP. 8' MASONRY SCREEN WALL 50'265'END OF PROP. 8' MASONRY SCREEN WALL BEGINNING OF PROP. 8' MASONRY SCREEN WALL 10' MASONRY SCREEN WALL 105.27'PROPOSED DUMPSTER ENCLOSURE W/ 8' MASONRY SCREEN WALL 38.39' PRELIMINARY PAUL BARTEL 136395 P.E. NO. 8/17/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\ZONING SET\C9-FENCING PLAN-54063.dwg DATE: August 17, 2023, TIME: 4:39 PM, USER: ah4133 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 AUGUST, 2023 CAD PB AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYCITY CASE NO.:ZA23-00427.801 AC., REMAINDER OF TRACTA (11.208 AC.) JOHN FREEMANSURVEY, ABSTRACT NO. 5290 40'80' GRAPHIC SCALE - 1"=40'N10 FENCING PLAN LEGEND 8' MASONRY FENCE BENCHMARK LIST POINT #NORTHING (Y)EASTING (X)ELEVATION DESCRIPTION 101 7,027,898.05 2,392,603.80 629.77 SXTP 102 7,028,201.15 2,392,556.93 632.14 SXTP 103 7,028,809.76 2,392,598.36 617.94 SXTP OWNER FLOOR & DECOR 2500 WINDY RIDGE PKWY SE ATLANTA, GA 30339 CONTACT: PHILIP COCHRAN EMAIL:PHILIP.COCHRAN@FLOORANDDECOR.COM TEL:(770)617-4262 ENGINEER HALFF ASSOCIATES, INC. 1201 N. BOWSER ROAD RICHARDSON, TX 75081 CONTACT: PAUL BARTEL EMAIL:PBARTEL@HALFF.COM TEL:(214)984-7321 628627628629 628 626627628 623 6246256626627625134567820'-0"FINISHED FLOOR9'-0" A.F.F.B.O. ACCENT BAND/REVEAL16'-0" A.F.F.B.O. ACCENT BAND/REVEAL17'-0" A.F.F.EXTERIOR LIGHTING25'-0" A.F.F.T.O. CONC PANEL47'-6 3/4"368'-1 3/8"54'-0"55'-0"55'-0"55'-0"55'-0"46'-6 3/4"12'-6" A.F.F.B.O. CANOPY36'-9" A.F.F.T.O. STUD WALL26'-7" A.F.F.T.O. TOWER37'-0" A.F.F.T.O. PARAPET26'-4" A.F.F.T.O. CONC. TOWER34'-7 1/2T.O. CONC. PANEL 28'-0" A.F.F.T.O. PARAPET25'-3" A.F.F.T.O. PARAPET19'-8" A.F.FT.O. CONC. PILASTER5'-6" FROMEYE LEVEL F.F5'-6" FROMEYE LEVEL F.F5'-6" FROMEYE LEVEL F.FEXTERIOR ELEVATIONS -SITE LINE STUDY - FRONTSL-2TMHJH; RRDRAWN:CHECKED:SHEETSEALISSUEGROSS BLDG AREA:JOB NUMBER: ISSUE DATE:STORE NUMBER:PROTOTYPE: 2500 WINDY RIDGEPARKWAY, SE ATLANTA, GA 30339CODE CONSULTANTS, INC.ST. LOUIS, MISSOURI 63146-42352043 WOODLAND PKWY, SUITE 300314-991-2633TMCONSULTING STRUCTURAL ENGINEERSScottsdale, Arizona 85251Phone: (602) 265-4331 Fax: (480) 663-1788A.V. SCHWAN & ASSOCIATES6000 E. Thomas Road, Suite 1Website: www.AVSchwan.comSBLM Architects33 Walt Whitman Road, Suite 300AHuntington Station, NY 11746Telephone 631 683 5588Fax 631 683 559102303675,120 SFT.B.D.T.B.D.2023 Q12185 E Southlake Blvd,Dallas [Southlake], TX 76092Dallas [Southlake], TX STORE #TBD HALFF ASSOCIATES, INC.711 N. CARANCAHUA ST., SUITE 1190CORPUS CHRISTI, TX 78401TELEPHONE: 361-400-0981Eric SeversonQuestions For dlb Call:Phone:dlb associatesCONSULTING ENGINEERS, P.C.(732) 774-20003600 Rt 66, Suite 150 #5981,Neptune, N.J. 07753CITY CASE NO. ZA23-0042ZONING SUBMISSION08/21/23 62862762862962862662762862566266275'-6" FROMEYE LEVEL F.F5'-6" FROMEYE LEVEL F.FABCDEF0'-0"FINISHED FLOOR9'-0" A.F.F.B.O. ACCENT BAND/REVEAL16'-0" A.F.F.B.O. ACCENT BAND/REVEAL20'-0" A.F.F.EXTERIOR LIGHTING38'-6"199'-8"49'-11"49'-11"49'-11"49'-11" 28'-0" A.F.F.T.O. PARAPET25'-0" A.F.F.T.O. CONC. PANEL25'-3" A.F.F.T.O. PARAPETEXTERIOR ELEVATIONS -SITE LINE STUDY - LEFTSL-1TMHJH; RRZONING SUBMISSION08/21/23DRAWN:CHECKED:SHEETSEALISSUEGROSS BLDG AREA:JOB NUMBER: ISSUE DATE:STORE NUMBER:PROTOTYPE: 2500 WINDY RIDGEPARKWAY, SE ATLANTA, GA 30339CODE CONSULTANTS, INC.ST. LOUIS, MISSOURI 63146-42352043 WOODLAND PKWY, SUITE 300314-991-2633TMCONSULTING STRUCTURAL ENGINEERSScottsdale, Arizona 85251Phone: (602) 265-4331 Fax: (480) 663-1788A.V. SCHWAN & ASSOCIATES6000 E. Thomas Road, Suite 1Website: www.AVSchwan.comSBLM Architects33 Walt Whitman Road, Suite 300AHuntington Station, NY 11746Telephone 631 683 5588Fax 631 683 559102303675,120 SFT.B.D.T.B.D.2023 Q12185 E Southlake Blvd,Dallas [Southlake], TX 76092Dallas [Southlake], TX STORE #TBD HALFF ASSOCIATES, INC.711 N. CARANCAHUA ST., SUITE 1190CORPUS CHRISTI, TX 78401TELEPHONE: 361-400-0981Eric SeversonQuestions For dlb Call:Phone:dlb associatesCONSULTING ENGINEERS, P.C.(732) 774-20003600 Rt 66, Suite 150 #5981,Neptune, N.J. 07753CITY CASE NO. ZA23-0042 625 625 625 630 630 630 621 621 621 6 2 1 622 622 622 622 6 2 2 623 623 6 2 3 624 624 62 4 626 626 626 627 627 627 628 628 628 629 629 629 631 631 631 632 632 633 633 634 634 625 622 622623 6 2 3 624 626 627 628620 620625625630630617617 61761861961962162162162162262262262262362362362362462462462462662662762762862862962963163163263263363363463 4 625624626627628629EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINE EX. 8" WATER LINEEX. 6" WATER LINEEX. 6" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8'x4' RCBC EX. 18" RCPEX. 36" RCPEX. 36" RCP EX. 24" RCPEX. 18" RCPEX. 42" RCP EX. 24" HDPE EX. 24" HDPEEX. 24" HDPE EX. 7'x5' RCBCEX. 18 " RCP EX. 8'x4' RCBC EX. 7'x5' RCBC EX. 30" RCP EX. 30" RCP EX. 18" RCPEX. 7'x5' RCBCEX. 7'x5' RCBC EX. 18" RCP EX. 7'x5' RCBC EX. 30" RCP EX. 21" RCPE X . 5 4 " RC P EX. 36" RCPEX. 30" RCP EX. 18" RCPEX. 42" RCPEX. U.G.E.EX. U.G.E.EX. U.G.E.EX. U.G.E. EX. U.G.E.EX. U.G.E.EX. 42" RCPEX. 8" WATER LINES. VILLAGE CENTER DRIVE (60' R.OW.) INSTR. NO. D214263624 LOT 1R, BLOCK 1 CARROLL ISD NO. 4 ADDITION CABINET A, SLIDE 13019 ZONING. CS LUD. PUBLIC/SEMI-PUBLIC LOT 1R, BLOCK 1 GATEWAY CHURCH ADDITION CABINET A, SLIDE 7866 ZONING. CS LUD. OFFICE COMMERCIAL LOT 1, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL LOT 2, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL 339,859 SQ. FT. OR 7.802 ACRES (REMAINDER OF A CALLED 11.208 ACRE TRACT) GREENWAY-1709/ELEVEN PARTNERS, L.P. INST. NO D197109628 LOT 1, BLOCK 1KIMBALL CROSSINGCFF. NO. D212098905ZONING. SP1LUD. RETAIL COMMERCIALLOT 1, BLOCK 1ETHAN ALLEN 1709 ADDITIONCAB. A, P, 11456INST. NO. D206305193ZONING. SP1LUD. RETAIL COMMERCIALFLOOR & DECOR 1 STORY 75,078 SF. FF = 629.50 10 9 8 43 8 12 12 6 12 12 11 PROP. DETENTION BASIN 100-YR WSE = 616.65 625626627628628 629 630 629 631 628 625 626 627 628621621622623 625626627628624RIDGERIDGE RIDGE RIDGE RIDGE RIDGE RIDGE 625 622623624 626 627 6 2 5 6 2 1 6 2 2 6 2 3 6 2 4 6 2 6 6 2 7 6 2 8 6 2 7 627 620621622623624620 621622623624615616617618617618619GRADE BREAK GRADE BREAK GRADE BREAK GRADE BREAK 627 627 6256246246256 2 5626 RIDGE626 EX. 15' STORM DRAINAGE EASEMENT (CCF NO. D212098905) EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 10' UTILITY EASEMENT (CAB.A. P. 11456 P.R.T.C.T.) EX. 15' UTILITY EASEMENT EX. 15' UTILITY EASEMENT EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. D212098905) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. 214218746) EX. 15' UTILITY EASEMENT (CCF NO. D212098905) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. VARIABLE WIDTH COMMON ACCESS EASEMENT (INST. NO. D206305192) EX. 29' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. 15' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. 214218746) 30' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 30' COMMON ACCESS, UTILITY (INST.AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 15' SANITARY SEWER EASEMENT (INST. NO. D214263624) 20' BUFFERYARD TYPE C 10' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 60' R.O.W. DEDICATION N00°10'55"W 592.90'N89°34'50"E237.38'S00°14'24"E 50.00'N89°34'50"E341.93'N00°02'16"W 372.29' S00°02'16"E 967.50'S89°48'13"W589.98'EX. 10' UTILITY EASEMENT (INST. NO. D214263624) 2% 2% 628.7± MATCH EX. 629.3± MATCH EX. 626.99 627.24 627.54 629.52 629.22 629.46 630.9± MATCH EX. 629.8± MATCH EX. 628.68 627.92 628.22 624.98 624.68 623.69 623.03 628.02 628.51 628.87 628.84 629.36 629.21 624.78 626.54 625.44 628.71628.87 627.97 628.51 628.87 628.37 627.81 625.44 626.33 624.71 623.59 624.46 629.19 629.00 628.26 628.10 627.80 624.92 629.32 629.50 627.66 626.76 626.59 625.59 626.36 625.16 625.45 625.50 625.50 624.56 624.70624.70 623.73 625.50 624.13 623.73 625.40 626.76 626.67 625.15 624.94 625.74 625.82 626.78 626.53 627.72 626.39 628.87 619.60 613.00 618.8± MATCH EX. 618.6± MATCH EX. 618.6± MATCH EX. 618.0± MATCH EX.624.75 616.56 624.74 618.5± MATCH EX. 624.05 618.3± MATCH EX. 627.17 627.09 628.18 627.9± MATCH EX. 628.1± MATCH EX. 627.8± MATCH EX. 626.97 627.05 628.0± MATCH EX. 628.29 628.04 628.15 628.54 628.65 627.8± MATCH EX. 628.70 628.59 621.84 626.22 624.59 623.89 622.1± MATCH EX. 621.59 620.51 621.17 621.47 EXISTING TREES TO REMAIN NO SITE DISTURBANCE SHALL BE UNDERTAKEN HERE 626.54 EX. 175' WIDE DRAINAGE & UTILITY EASEMENT TO BE ABANDONED VOL.12585, PG. 2118 PROPOSED TOE WALL 5' CURB CUT W/ FLUME 621.04 620.19 624.36622.86 628.87 627.34 625.89 626.13 626.98 626.67 625.86 627.79 627.27 2.7%5.0%3.0%2.6%2.6% 2.1%1.0%1.2%2.6%2.8% 3.0% 1.2% 2.9% 2.1% 4.0% 3.3% 2.0 % 621.07 620.27 628.87 629.36 628.99 628.53 626.54 626.78 626.98 626.54628.53 628.51 624.79 21.9% 20.6% EXISTING LEGEND: OHE EX. 8'' W EX. 8'' SS MAJOR CONTOUR LINE FENCE IRRIGATION CONTROL VALVE FIRE HYDRANT BOLLARD SIGN LIGHT POLE AIR CONDITIONING UNIT MANHOLE MONITORING WELL ELECTRIC METER SANITARY SEWER CLEANOUT WATER LINE GAS LINE MINOR CONTOUR LINE PROPERTY LINE OVERHEAD ELECTRIC WATER METER WATER VALVE VAULT FIRE DEPARTMENT CONNECTION GUY WIRE BILLBOARD POWER POLE GAS METER GROUND LIGHT SANITARY SEWER LINE UNDERGROUND TELEPHONE LINE UNDERGROUND COMMUNICATIONS LINE EX. GAS UGT UGC STORM SEWER LINE GRATE INLET LOT LINE EASEMENT LINE FENCE POST CURB INLET GRADING LEGEND RIDGE LINE GRADE BREAK FLOW ARROW GB PROPOSED ELEVATION 405.00 PROP. MAJOR CONTOUR PROP. MINOR CONTOUR 405 406 PROPOSED RETAINING WALL PRELIMINARY PAUL BARTEL 136395 P.E. NO. 8/17/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\ZONING SET\C2-GP-54063.dwg DATE: August 17, 2023, TIME: 4:36 PM, USER: ah4133 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 AUGUST, 2023 CAD PB AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYMATCH EXISTING ELEVATION405.00± MATCH EX. CITY CASE NO.:ZA23-00427.801 AC., REMAINDER OF TRACTA (11.208 AC.) JOHN FREEMANSURVEY, ABSTRACT NO. 5290 40'80' GRAPHIC SCALE - 1"=40'N2 OVERALL GRADING PLAN ENGINEER HALFF ASSOCIATES, INC. 1201 N. BOWSER ROAD RICHARDSON, TX 75081 CONTACT: PAUL BARTEL EMAIL:PBARTEL@HALFF.COM TEL:(214)984-7321 OWNER FLOOR & DECOR 2500 WINDY RIDGE PKWY SE ATLANTA, GA 30339 CONTACT: PHILIP COCHRAN EMAIL:PHILIP.COCHRAN@FLOORANDDECOR.COM TEL:(770)617-4262 BENCHMARK LIST POINT #NORTHING (Y)EASTING (X)ELEVATION DESCRIPTION 101 7,027,898.05 2,392,603.80 629.77 SXTP 102 7,028,201.15 2,392,556.93 632.14 SXTP 103 7,028,809.76 2,392,598.36 617.94 SXTP 3 KIMBALL OAKS DRAINAGE AREA MAP PRELIMINARY PAUL BARTEL 136395 P.E. NO. 8/17/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\ZONING SET\C3A-ASBUILT EDAMN-54063.dwg DATE: August 17, 2023, TIME: 4:36 PM, USER: ah4133 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 AUGUST, 2023 CAD PB AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYCITY CASE NO.:ZA23-00427.801 AC., REMAINDER OF TRACTA (11.208 AC.) JOHN FREEMANSURVEY, ABSTRACT NO. 529NOTE: N.T.S FOR INFORMATION ONLY EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINE EX. 8" WATER LINEEX. 8" WATER LINEEX. 8" WATER LINEEX. 6" WATER LINEEX. 6" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 48" RCPEX. 8'x4' RCBC EX. 8'x4' RCBCEX. 18 " HDPEEX. 18" RCPEX. 36" RCPEX. 36" RCP EX. 24" RCPEX. 18" RCPEX. 42" RCP EX. 24" HDPE EX. 24" HDPEEX. 24" RCPEX. 24" HDPE EX. 7'x5' RCBCEX. 30" RCPEX. 18 " RCP EX. 8'x4' RCBC E X . 2 4 " R C PEX. 48" RCPEX. 48" RCPEX. 36" RCPEX. 4 2" R C P EX. 24" RCPEX. 7'x5' RCBC EX. 30" RCP E X . 5 4 " RC PEX. 60 " RCPEX. 48" RCPEX. 54" RCPEX. 30" RCP EX. 18" RCPEX. 7'x5' RCBCEX. 7'x5' RCBC EX. 18" RCP EX. 7'x5' RCBC EX. 30" RCP EX. 21" RCPE X . 5 4 " RC P EX. 21" RCPEX. 36" RCPEX. 30" RCP EX. 18" RCPEX. 18" RCPEX. 42" RCPEX. U.G.E.EX. U.G.E.EX. U.G.E.EX. U.G.E. EX. U.G.E.EX. U.G.E.EX. 42" RCPEX. 36" RCPEX. 8" WATER LINE339,859 SQ. FT. OR 7.802 ACRES (REMAINDER OF A CALLED 11.208 ACRE TRACT) GREENWAY-1709/ELEVEN PARTNERS, L.P. INST. NO D197109628 625 625 625 630 630 630 621 621 621 6 2 1 622 622 622 622 6 2 2 623 623 6 2 3 624 624 62 4 626 626 626 627 627 627 628 628 628 629 629 629 631 631 631 632 632 633 633 634 634 625 622 622623 6 2 3 624 626 627 628620 62062562563063061761761761861961962162162162162262262262262362362362362462462462462662662762762862862962963163163263263363363463 4 625624626627628629EX. 175' STORM EASEMENT TO BE ABANDONED S. VILLAGE CENTER DRIVE (60' R.OW.) INSTR. NO. D214263624 LOT 1R, BLOCK 1 CARROLL ISD NO. 4 ADDITION CABINET A, SLIDE 13019 ZONING. CS LUD. PUBLIC/SEMI-PUBLIC LOT 1R, BLOCK 1 GATEWAY CHURCH ADDITION CABINET A, SLIDE 7866 ZONING. CS LUD. OFFICE COMMERCIAL LOT 1, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL LOT 2, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL LOT 1, BLOCK 1KIMBALL CROSSINGCFF. NO. D212098905ZONING. SP1LUD. RETAIL COMMERCIALLOT 1, BLOCK 1ETHAN ALLEN 1709 ADDITIONCAB. A, P, 11456INST. NO. D206305193ZONING. SP1LUD. RETAIL COMMERCIALEX. 24' C.A.E.(CAB. "A", PG. 11456P.R.T.C.T.)EX. 50' BUILDING SETBACKEX. 20' C.A.E. (INST. NO. D206305192) EX. 15' STORM DRAINAGE EASEMENT (CCF NO. D212098905) EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 10' UTILITY EASEMENT (CAB.A. P. 11456 P.R.T.C.T.) EX. 15' UTILITY EASEMENT EX. 15' UTILITY EASEMENT EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. D212098905) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. 214218746) EX. 15' UTILITY EASEMENT (CCF NO. D212098905) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. VARIABLE WIDTH COMMON ACCESS EASEMENT (INST. NO. D206305192) EX. 29' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. 15' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. 214218746) 30' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 30' COMMON ACCESS, UTILITY (INST.AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 15' SANITARY SEWER EASEMENT (INST. NO. D214263624) EX. 15' SANITARY SEWER EASEMENT EX. 20' PIPELINE EASEMENT N00°10'55"W 592.90'N89°34'50"E237.38'S00°14'24"E 50.00'N89°34'50"E341.93'N00°02'16"W 372.29' S89°34'26"W 30.00' N00°02'16"W 50.00' S00°02'16"E 967.50'S89°48'13"W589.98'EX. 10' UTILITY EASEMENT (INST. NO. D214263624) QEX = 0.00 CFS QALLOW = 11.75 CFS REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, DATED/APPROVED 02/21/2014. EX. 'Y' INLET OS-2 QEX = 10.79 CFS QALLOW = 32.08 CFS QEX = 0.00 CFS REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, DATED/APPROVED 02/21/2014. EX. 'Y' INLET OS-1 QEX = 11.04 CFS QALLOW = 20.77 CFS QEX = 24.24 CFS REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, DATED/APPROVED 02/21/2014. SWALE DENOTED PER ETHAN ALLEN AS-BUILT CIVIL PLANS DATED/APPROVED 11/6/2008. OFFSITE PROPERTY DRAINS AWAY FROM DEVELOPMENT PER KIMBALL CROSSING AS-BUILT CIVIL PLANS DATED/APPROVED 10/10/2012. SWALE DENOTED PER CHEATHAM & ASSOCIATES AS-BUILT CIVIL PLANS DATED/APPROVED 3/31/00. ONSITE UNCHANGED FLOW REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, DATED/APPROVED 02/21/2014 FOR BREAKDOWN. REFER TO KIMBALL CROSSING AS-BUILT CIVIL PLANS, DATED/APPROVED 10/10/2012 FOR BREAKDOWN. EX. 10' CURB INLET EX-4EX. 10' CURB INLET EX-6 EX. CURB INLET EX-3 QEX = 2.41 CFS (SEE DRAINAGE NOTE 1 THIS SHEET) 0 50'100' GRAPHIC SCALE - 1"=50'N4 EXISTING DRAINAGE AREA MAP ENGINEER HALFF ASSOCIATES, INC. 1201 N. BOWSER ROAD RICHARDSON, TX 75081 CONTACT: PAUL BARTEL EMAIL:PBARTEL@HALFF.COM TEL:(214)984-7321 OWNER FLOOR & DECOR 2500 WINDY RIDGE PKWY SE ATLANTA, GA 30339 CONTACT: PHILIP COCHRAN EMAIL:PHILIP.COCHRAN@FLOORANDDECOR.COM TEL:(770)617-4262 BENCHMARK LIST POINT #NORTHING (Y)EASTING (X)ELEVATION DESCRIPTION 101 7,027,898.05 2,392,603.80 629.77 SXTP 102 7,028,201.15 2,392,556.93 632.14 SXTP 103 7,028,809.76 2,392,598.36 617.94 SXTP EXISTING LEGEND: OHE EX. 8'' W EX. 8'' SS MAJOR CONTOUR LINE FENCE IRRIGATION CONTROL VALVE FIRE HYDRANT BOLLARD SIGN LIGHT POLE AIR CONDITIONING UNIT MANHOLE MONITORING WELL ELECTRIC METER SANITARY SEWER CLEANOUT WATER LINE GAS LINE MINOR CONTOUR LINE PROPERTY LINE OVERHEAD ELECTRIC WATER METER WATER VALVE VAULT FIRE DEPARTMENT CONNECTION GUY WIRE BILLBOARD POWER POLE GAS METER GROUND LIGHT SANITARY SEWER LINE UNDERGROUND TELEPHONE LINE UNDERGROUND COMMUNICATIONS LINE EX. GAS UGT UGC STORM SEWER LINE GRATE INLET LOT LINE EASEMENT LINE FENCE POST CURB INLET PRELIMINARY PAUL BARTEL 136395 P.E. NO. 8/17/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\ZONING SET\C3-EDAMN-54063.dwg DATE: August 17, 2023, TIME: 4:36 PM, USER: ah4133 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 AUGUST, 2023 CAD PB AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYCITY CASE NO.:ZA23-00427.801 AC., REMAINDER OF TRACTA (11.208 AC.) JOHN FREEMANSURVEY, ABSTRACT NO. 529---- EX-1 2.57 DRAINAGE AREA AREA (ACRE)FLOW (CFS) DRAINAGE LEGEND: EXISTING DRAINAGE AREAS DA AREA C CF CF C*A*CF Tc I1 Q1 I5 Q5 I10 Q10 I100 C*A*CF Q100 NAME (acres)1YR-10YR 100 YR 1YR-10 YR (min)(in/hr)(cfs)(in/hr)(cfs)(in/hr)(cfs)(in/hr)100 YR (cfs)COMMENTS EX-1 3.87 0.30 1.00 1.00 1.16 10.0 3.98 4.6 5.72 6.6 6.61 7.7 9.24 1.16 10.72 To EX. 'Y' Inlet OS-1 EX-2 3.59 0.30 1.00 1.00 1.08 10.0 3.98 4.3 5.72 6.2 6.61 7.1 9.24 1.08 9.96 To EX. 'Y' Inlet OS-2 EX-3 0.08 0.80 1.00 1.00 0.07 10.0 3.98 0.3 5.72 0.4 6.61 0.4 9.24 0.07 0.63 To Ex. Curb Inlet EX-3 EX-4 0.09 0.80 1.00 1.00 0.07 10.0 3.98 0.3 5.72 0.4 6.61 0.5 9.24 0.07 0.68 To Ex. 10' Curb Inlet EX-4 EX-5 0.02 0.80 1.00 1.00 0.02 10.0 3.98 0.1 5.72 0.1 6.61 0.1 9.24 0.02 0.16 To EX. 'Y' Inlet OS-2 EX-6 0.01 0.80 1.00 1.00 0.01 10.0 3.98 0.0 5.72 0.0 6.61 0.1 9.24 0.01 0.07 To Ex. 10' Curb Inlet EX-6 OS-1 0.12 0.30 1.00 1.00 0.03 10.0 3.98 0.1 5.72 0.2 6.61 0.2 9.24 0.03 0.32 To EX. 'Y' Inlet OS-1 OS-2 0.16 0.30 1.00 1.00 0.05 10.0 3.98 0.2 5.72 0.3 6.61 0.3 9.24 0.05 0.45 To EX. 'Y' Inlet OS-2 OS-3 0.08 0.80 1.00 1.00 0.06 10.0 3.98 0.3 5.72 0.4 6.61 0.4 9.24 0.06 0.59 To EX-3 OS-4 0.86 0.80 1.00 1.00 0.69 10.0 3.98 2.7 5.72 3.9 6.61 4.5 9.24 0.69 6.34 To EX-4 OS-5 0.03 0.80 1.00 1.00 0.02 10.0 3.98 0.1 5.72 0.1 6.61 0.2 9.24 0.02 0.22 To EX-5 DRAINAGE NOTES: 1.EX. CURB INLET EX-3 FLOW WAS CALCULATED USING AREA EX-3 IN CONJUNCTION WITH KIMBALL OAKS AS-BUILT CIVIL PLANS DATED/APPROVED 2-21-14 DRAINAGE AREAS OS-2 & OS-3 (0.63 + 1.02 + 0.76 = 2.41 CFS). 2.AREA EX-4 & AREA OS-4 ARE BASED OFF AREA D4 PER KIMBALL OAKS AS-BUILT CIVIL PLANS DATED/APPROVED 2-21-14, DELINEATED BY THE PROPERTY LINE. 625 625 625 630 630 630 621 621 621 6 2 1 622 622 622 622 6 2 2 623 623 6 2 3 624 624 62 4 626 626 626 627 627 627 628 628 628 629 629 629 631 631 631 632 632 633 633 634 634 625 622 622623 6 2 3 624 626 627 628620 62062562563063061761761761861961962162162162162262262262262362362362362462462462462662662762762862862962963163163263263363363463 4 625624626627628629EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINE EX. 8" WATER LINEEX. 8" WATER LINEEX. 8" WATER LINEEX. 6" WATER LINEEX. 6" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8'X4' BOX CULVERT EX. 8'X4' BOX CULVERT EX. 8'X4' BOX CULVERT EX. 8'X4' BOX CULVERTEX. 36" RCPEX. 48" RCPEX. 8'x4' RCBC EX. 8'x4' RCBCEX. 18 " HDPE EX. 8'X4' BOX CULVERT EX. 18" RCPEX. 24" RCPEX. 18" RCPEX. 42" RCP EX. 48" RCPEX. 24" HDPE EX. 36" RCPEX. 48" RCPEX. 24" HDPEEX. 24" RCPEX. 24" HDPE EX. 7'x5' RCBCEX. 18 " RCP EX. 8'x4' RCBC E X . 2 4 " R C PEX. 48" RCPEX. 48" RCPEX. 48" RCPEX. 36" RCPEX. 4 2" R C P EX. 24" RCPEX. 7'x5' RCBC EX. 30" RCP EX. 48" RCPEX. 54" RCPEX. 30" RCP EX. 18" RCPEX. 7'x5' RCBCEX. 7'x5' RCBC EX. 18" RCP EX. 7'x5' RCBC EX. 21" RCPE X . 5 4 " RC P EX. 21" RCPEX. 36" RCPEX. 30" RCP EX. 18" RCPEX. 18" RCPEX. 42" RCPEX. U.G.E.EX. U.G.E.EX. U.G.E.EX. U.G.E. EX. U.G.E.EX. U.G.E.EX. 42" RCPEX. 36" RCPEX. 48" RCPEX. 8" WATER LINE339,859 SQ. FT. OR 7.802 ACRES (REMAINDER OF A CALLED 11.208 ACRE TRACT) GREENWAY-1709/ELEVEN PARTNERS, L.P. INST. NO D197109628 625626627628628 629 630 629 631 628 625 626 627 628621621622623 625626627628624RIDGERIDGE RIDGE RIDGE RIDGE RIDGE RIDGE 625 622623624 626 627 6 2 5 6 2 1 6 2 2 6 2 3 6 2 4 6 2 6 6 2 7 6 2 8 6 2 7 627 620621622623624620 621622623624615616617618617618619GRADE BREAK GRADE BREAK GRADE BREAK GRADE BREAK 627 627 6256246246256 2 5626 RIDGE626 FLOOR & DECOR1 STORY75,078 SF.FF = 629.5010 9 8 43 8 12 12 6 12 12 11 PROP. DETENTION BASIN 100-YR WSE = 616.65 S. VILLAGE CENTER DRIVE (60' R.OW.) INSTR. NO. D214263624 LOT 1R, BLOCK 1 CARROLL ISD NO. 4 ADDITION CABINET A, SLIDE 13019 ZONING. CS LUD. PUBLIC/SEMI-PUBLIC LUD. OFFICE COMMERCIAL LOT 1, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL LOT 2, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL E. SOUTHLAKE BOULEVARD (F.M. 1709) (Variable Width R.OW.)LOT 1, BLOCK 1KIMBALL CROSSINGCFF. NO. D212098905ZONING. SP1LUD. RETAIL COMMERCIALLOT 1, BLOCK 1ETHAN ALLEN 1709 ADDITIONCAB. A, P, 11456INST. NO. D206305193ZONING. SP1LUD. RETAIL COMMERCIALDISCHARGE POINT 2 QALLOW = 11.75 CFS QPROP = 2.57 CFS REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, (AREA E1) DATED/APPROVED 02/21/2014. DISCHARGE POINT 4 QALLOW = 81.5 CFS QPROP = 79.55 CFS REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS DATED/APPROVED 02/21/2014. Q100-YR = 213.00 CFS REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, DATED/APPROVED 02/21/2014. DISCHARGE POINT 3 QALLOW = 256.83 CFS QPROP = 256.83 CFS REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, DATED/APPROVED 02/21/2014. DISCHARGE POINT 1 QALLOW = 32.08 CFS QPROP = 41.26 CFS REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, (AREA E3) DATED/APPROVED 02/21/2014. Q100-YR = 58.90 CFS REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, DATED/APPROVED 02/21/2014. EX. 'Y' INLET OS-1 Q100-YR = 0.98 CFS EX. CURB INLET EX-3 Q100-YR = 3.71 CFS (SEE DRAINAGE NOTE 6 THIS SHEET) SWALE DENOTED PER CHEATHAM & ASSOCIATES AS-BUILT CIVIL PLANS DATED/APPROVED 3/31/00. DISCHARGE POINT 5 QALLOW = 7.02 CFS QPROP = 7.53 CFS REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, (AREA E3) DATED/APPROVED 02/21/2014. ONSITE UNCHANGED FLOW REFER TO KIMBALL OAKS AS-BUILT CIVIL PLANS, DATED/APPROVED 02/21/2014 FOR BREAKDOWN. REFER TO KIMBALL CROSSING AS-BUILT CIVIL PLANS, DATED/APPROVED 10/10/2012 FOR BREAKDOWN. EX. 'Y' INLET OS-2 Q100-YR = 15.96 CFS EX. 10' CURB INLET EX-4 (TO BE REMOVED) EX. 10' CURB INLET EX-6 PROP. 2-GRATE INLET C-1 PROP. 2-GRATE INLET C-3 PROP. 4-GRATE INLET C-2 PROP. 4-GRATE INLET A-3 PROP. 20' CURB INLET INLET D-1 PROP. 6-GRATE INLET A-2 PROP. 3'x3' LANDSCAPE INLET A-1 PROP. 3'x3' 'Y' INLET A-0 EX. 24' C.A.E.(CAB. "A", PG. 11456P.R.T.C.T.)EX. 50' BUILDING SETBACKEX. 20' C.A.E. (INST. NO. D206305192) EX. 15' STORM DRAINAGE EASEMENT (CCF NO. D212098905) EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 10' UTILITY EASEMENT (CAB.A. P. 11456 P.R.T.C.T.) EX. 15' UTILITY EASEMENT EX. 15' STORM DRAINAGE EASEMENT (INST. NO. D212098905) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. 214218746) EX. 15' UTILITY EASEMENT (CCF NO. D212098905) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. VARIABLE WIDTH COMMON ACCESS EASEMENT (INST. NO. D206305192) EX. 29' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. 15' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. 214218746) 30' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 30' COMMON ACCESS, UTILITY (INST.AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 15' SANITARY SEWER EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 15' SANITARY SEWER EASEMENT EX. 20' PIPELINE EASEMENT 60' R.O.W. DEDICATION N00°10'55"W 592.90'N89°34'50"E237.38'S00°14'24"E 50.00'N89°34'50"E341.93'N00°02'16"W 372.29' S89°34'26"W 30.00' N00°02'16"W 50.00' N89°34'26"E 42.00' S00°02'16"E 967.50'S89°48'13"W589.98'EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EXISTING LEGEND: OHE EX. 8'' W EX. 8'' SS MAJOR CONTOUR LINE FENCE IRRIGATION CONTROL VALVE FIRE HYDRANT BOLLARD SIGN LIGHT POLE AIR CONDITIONING UNIT MANHOLE MONITORING WELL ELECTRIC METER SANITARY SEWER CLEANOUT WATER LINE GAS LINE MINOR CONTOUR LINE PROPERTY LINE OVERHEAD ELECTRIC WATER METER WATER VALVE VAULT FIRE DEPARTMENT CONNECTION GUY WIRE BILLBOARD POWER POLE GAS METER GROUND LIGHT SANITARY SEWER LINE UNDERGROUND TELEPHONE LINE UNDERGROUND COMMUNICATIONS LINE EX. GAS UGT UGC STORM SEWER LINE GRATE INLET LOT LINE EASEMENT LINE FENCE POST CURB INLET PRELIMINARY PAUL BARTEL 136395 P.E. NO. 8/17/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\ZONING SET\C4-PDAM-54063.dwg DATE: August 17, 2023, TIME: 4:37 PM, USER: ah4133 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 AUGUST, 2023 CAD PB AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYCITY CASE NO.:ZA23-00427.801 AC., REMAINDER OF TRACTA (11.208 AC.) JOHN FREEMANSURVEY, ABSTRACT NO. 5290 50'100' GRAPHIC SCALE - 1"=50'N5 PROPOSED DRAINAGE AREA MAP **USED AREA FROM KIMBALL OAKS AS-BUILT CIVIL PLANS DATED/APPROVED 02/21/2014 *USED C-FACTOR OF 0.80 FOR OFF-SITE DRAINAGE ---- EX-1 2.57 DRAINAGE AREA AREA (ACRE)FLOW (CFS) ENGINEER HALFF ASSOCIATES, INC. 1201 N. BOWSER ROAD RICHARDSON, TX 75081 CONTACT: PAUL BARTEL EMAIL:PBARTEL@HALFF.COM TEL:(214)984-7321 OWNER FLOOR & DECOR 2500 WINDY RIDGE PKWY SE ATLANTA, GA 30339 CONTACT: PHILIP COCHRAN EMAIL:PHILIP.COCHRAN@FLOORANDDECOR.COM TEL:(770)617-4262 DRAINAGE LEGEND: BENCHMARK LIST POINT #NORTHING (Y)EASTING (X)ELEVATION DESCRIPTION 101 7,027,898.05 2,392,603.80 629.77 SXTP 102 7,028,201.15 2,392,556.93 632.14 SXTP 103 7,028,809.76 2,392,598.36 617.94 SXTP DRAINAGE NOTES: 1.ALL FLOW RATES LISTED BELOW ARE BASED ON THE 100-YEAR STORM EVENT. 2.AREAS "S" AND "E" FROM DRAINAGE AREA MAP BY CHEATHAM & ASSOCIATES, DATED 10-12-00 FOR OFFSITE "DRAINAGE AND SANITARY SEWER IMPROVEMENTS TO SERVE NEW INTERMEDIATE/MIDDLE SCHOOL", "DRAINAGE AREA MAP AND HYDRAULIC COMPUTATIONS" CONTRIBUTE TO THE EXISTING 5 - 8'x4' R.C.B.C. BORDERING THE SITE, DESIGN Q FROM THESE AREAS IS 95.1 CFS (FROM "S" DETAINED) AND 117.9 CFS (FROM "E" UNDETAINED), TOTALING 213.0 CFS. 3.PER KIMBALL OAKS AS-BUILT CIVIL PLANS DATED/APPROVED 2-21-14, AN ALLOWABLE FLOW OF 32.08 CFS (AREA E3) WAS DESIGNED FOR DISCHARGE POINT 1, AND AN ALLOWABLE FLOW OF 11.75 CFS (AREA E1) WAS DESIGNED FOR DISCHARGE POINT 2. COMBINING THESE ALLOWABLE FLOWS WITH THE EX. OFFSITE FLOW OF 213 CFS FROM "INTERMEDIATE/MIDDLE SCHOOL", RESULTS IN A TOTAL ALLOWABLE FLOW OF 256.83 CFS AT DISCHARGE POINT 3. 4.FOR THIS DEVELOPMENT, A PROP. FLOW OF 41.26 CFS WILL BE SENT TO DISCHARGE POINT 1 AND A PROP. FLOW OF 2.57 CFS WILL BE SENT TO DISCHARGE POINT 2. COMBINING THESE PROPOSED FLOWS WITH THE EX. OFFSITE FLOW OF 213 CFS FROM "INTERMEDIATE/MIDDLE SCHOOL", WILL RESULT IN A TOTAL PROP. FLOW OF 256.83 CFS AT DISCHARGE POINT 3. 5.DUE TO THE PROP. FLOW EXCEEDING THE ALLOWABLE FLOW AT DISCHARGE POINT 1 (41.26 - 32.08 = 9.18 CFS) DETENTION IS REQUIRED TO REDUCE THE PROP. FLOW TO DISCHARGE POINT 2 TO A RATE OF (11.75 - 9.18 = 2.57 CFS). HALFF HAS VERIFIED THAT THE EX. STORM CONVEYANCE SYSTEM CAN ACCEPT ADDITIONAL FLOW FROM DISCHARGE POINT 1. 6.3.71 CFS WAS CALCULATED USING PROPOSED DRAINAGE AREAS C-0A, C-0B, AND EX-3 IN CONJUNCTION WITH KIMBALL OAKS AS-BUILT CIVIL PLANS DATED/APPROVED 2-21-14 DRAINAGE AREAS OS-2 & OS-3. (0.77 + 0.70 + 0.46 + 1.02 + 0.76 = 3.71 CFS). 7.PER KIMBALL OAKS AS-BUILT CIVIL PLANS DATED/APPROVED 2-21-14, A FLOW OF 7.02 CFS DRAINS TO EX. INLET EX-4 (AREA D4 PER KIMBALL OAKS PLAN). INLET EX-4 IS TO BE REMOVED & RELOCATED, RESULTING IN AN INCREASE OF FLOW OF 0.51 CFS (D1 - EX4). AT THE SAME TIME, THE PROPOSED NORTHERN DRIVE WILL ACCEPT 0.59 CFS (C3-OFF) FROM THE SAME OFFSITE SYSTEM. GRADING LEGEND RIDGE LINE GRADE BREAK FLOW ARROW GB PROPOSED ELEVATION 405.00 PROP. MAJOR CONTOUR PROP. MINOR CONTOUR 405 406 PROPOSED RETAINING WALL MATCH EXISTING ELEVATION405.00± MATCH EX. DISCHARGE POINTS 1*2 3 4 5 Q100 (ALLOWABLE IN CFS)32.08 CFS 11.75 CFS 256.83 CFS 81.50 CFS 7.02 CFS Q100 (PROPOSED IN CFS)41.26 CFS 2.57 CFS 256.83 CFS 79.55 CFS 7.55 CFS DELTA (PROPOSED-ALLOWABLE)9.18 CFS -9.18 CFS 0.00 CFS -1.95 CFS 0.53 CFS * REFER TO DRAINAGE NOTE 5. PROPOSED DRAINAGE AREAS DA AREA C CF CF C*A*CF Tc I1 Q1 I5 Q5 I10 Q10 I100 C*A*CF Q100 NAME (acres)1YR-10 YR 100 YR 1YR-10 YR (min)(in/hr)(cfs)(in/hr)(cfs)(in/hr)(cfs)(in/hr)100 YR (cfs)COMMENTS A-0 0.31 0.70 1.00 1.25 0.22 10.0 3.98 0.9 5.72 1.2 6.61 1.4 9.67 0.27 2.61 To Prop. 3'x3' 'Y' Inlet A-0 A-1 0.29 0.70 1.00 1.25 0.20 10.0 3.98 0.8 5.72 1.2 6.61 1.3 9.67 0.25 2.44 To Prop. 3'x3' Landscape Inlet A-1 A-2 1.77 0.70 1.00 1.25 1.24 10.0 3.98 4.9 5.72 7.1 6.61 8.2 9.67 1.55 14.99 To Prop. 6-Grate Inlet A-2 A-3 1.11 0.70 1.00 1.25 0.78 10.0 3.98 3.1 5.72 4.5 6.61 5.1 9.67 0.97 9.42 To Prop. 4-Grate Inlet A-3 A-4 1.39 0.70 1.00 1.25 0.98 10.0 3.98 3.9 5.72 5.6 6.61 6.4 9.67 1.22 11.79 To Prop. 3'x3' 'Y' Inlet A-0 B 0.74 0.70 1.00 1.25 0.52 10.0 3.98 2.1 5.72 3.0 6.61 3.4 9.67 0.65 6.24 To Prop. Pond C-0A 0.09 0.70 1.00 1.25 0.06 10.0 3.98 0.3 5.72 0.4 6.61 0.4 9.67 0.08 0.77 To Ex. Curb Inlet EX-3 C-0B 0.08 0.70 1.00 1.25 0.06 10.0 3.98 0.2 5.72 0.3 6.61 0.4 9.67 0.07 0.70 To Ex. Curb Inlet EX-3 C-0C 0.05 0.70 1.00 1.25 0.03 10.0 3.98 0.1 5.72 0.2 6.61 0.2 9.67 0.04 0.39 To Ex. 'Y' Inlet OS-2 C-0D 0.08 0.70 1.00 1.25 0.05 10.0 3.98 0.2 5.72 0.3 6.61 0.4 9.67 0.07 0.66 To Ex. 'Y' Inlet OS-2 C-1 0.50 0.70 1.00 1.25 0.35 10.0 3.98 1.4 5.72 2.0 6.61 2.3 9.67 0.44 4.21 To Prop. 2-Grate Inlet C-1 C-2 0.68 0.70 1.00 1.25 0.48 10.0 3.98 1.9 5.72 2.7 6.61 3.2 9.67 0.60 5.77 To Prop. 2-Grate Inlet C-2 C-3 0.51 0.70 1.00 1.25 0.36 10.0 3.98 1.4 5.72 2.0 6.61 2.4 9.67 0.45 4.31 To Prop. 2-Grate Inlet C-3 C-4 0.12 0.70 1.00 1.25 0.08 10.0 3.98 0.3 5.72 0.5 6.61 0.5 9.67 0.10 0.98 To Ex. 'Y' Inlet OS-1 D-1 0.14 0.70 1.00 1.25 0.10 10.0 3.98 0.4 5.72 0.6 6.61 0.7 9.67 0.12 1.19 To Prop. 20' Curb Inlet D-1 D1-OFF**0.86 0.80 1.00 1.00 0.69 10.0 3.98 2.7 5.72 3.9 6.61 4.5 9.24 0.69 6.34 To Prop. 20' Curb Inlet D-1 C3-OFF**0.08 0.80 1.00 1.00 0.06 10.0 3.98 0.3 5.72 0.4 6.61 0.4 9.24 0.06 0.59 To Prop. 2-Grate Inlet C-3 EX-3*0.06 0.80 1.00 1.00 0.05 10.0 3.98 0.2 5.72 0.3 6.61 0.3 9.24 0.05 0.46 To Ex. Curb Inlet EX-3 EX-5*0.02 0.80 1.00 1.00 0.02 10.0 3.98 0.1 5.72 0.1 6.61 0.1 9.24 0.02 0.16 To Prop. 3'x3' 'Y' Inlet A-0 EX-6*0.01 0.80 1.00 1.00 0.01 10.0 3.98 0.0 5.72 0.0 6.61 0.1 9.24 0.01 0.07 To Ex. 10' Curb Inlet EX-6 OS-5*0.03 0.80 1.00 1.00 0.02 10.0 3.98 0.1 5.72 0.1 6.61 0.2 9.24 0.02 0.22 To EX-5 625 625 625 630 630 630 621 621 621 6 2 1 622 622 622 622 6 2 2 623 623 6 2 3 624 624 62 4 626 626 626 627 627 627 628 628 628 629 629 629 631 631 631 632 632 633 633 634 634 625 622 622623 6 2 3 624 626 627 628620 620625625630630617617 61761861961962162162162162262262262262362362362362462462462462662662762762862862962963163163263263363363463 4 625624626627628629EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINE EX. 8" WATER LINEEX. 6" WATER LINEEX. 6" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8'x4' RCBC EX. 18" RCPEX. 36" RCPEX. 36" RCP EX. 24" RCPEX. 18" RCPEX. 42" RCP EX. 24" HDPE EX. 24" HDPEEX. 24" HDPE EX. 7'x5' RCBCEX. 18 " RCP EX. 8'x4' RCBC EX. 7'x5' RCBC EX. 30" RCP EX. 30" RCP EX. 18" RCPEX. 7'x5' RCBCEX. 7'x5' RCBC EX. 18" RCP EX. 7'x5' RCBC EX. 30" RCP EX. 21" RCPE X . 5 4 " RC P EX. 36" RCPEX. 30" RCP EX. 18" RCPEX. 42" RCPEX. U.G.E.EX. U.G.E.EX. U.G.E.EX. U.G.E. EX. U.G.E.EX. U.G.E.EX. 42" RCPEX. 8" WATER LINES. VILLAGE CENTER DRIVE (60' R.OW.) INSTR. NO. D214263624 LOT 1R, BLOCK 1 CARROLL ISD NO. 4 ADDITION CABINET A, SLIDE 13019 ZONING. CS LUD. PUBLIC/SEMI-PUBLIC LOT 1R, BLOCK 1 GATEWAY CHURCH ADDITION CABINET A, SLIDE 7866 ZONING. CS LUD. OFFICE COMMERCIAL LOT 1, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL LOT 2, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL 339,859 SQ. FT. OR 7.802 ACRES (REMAINDER OF A CALLED 11.208 ACRE TRACT) GREENWAY-1709/ELEVEN PARTNERS, L.P. INST. NO D197109628 LOT 1, BLOCK 1KIMBALL CROSSINGCFF. NO. D212098905ZONING. SP1LUD. RETAIL COMMERCIALLOT 1, BLOCK 1ETHAN ALLEN 1709 ADDITIONCAB. A, P, 11456INST. NO. D206305193ZONING. SP1LUD. RETAIL COMMERCIAL8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR0+001+002+003+004+005+006+00 7+00 8+009+0010+0011+0012+0012+818'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTRFDC 0+001+00 DCO8'' WW625626627628628 629 630 629 631 628 625 626 627 628621621622623 625626627628624RIDGERIDGE RIDGE RIDGE RIDGE RIDGE RIDGE 625 622623624 626 627 6 2 5 6 2 1 6 2 2 6 2 3 6 2 4 6 2 6 6 2 7 6 2 8 6 2 7 627 620621622623624620 621622623624615616617618617618619GRADE BREAK GRADE BREAK GRADE BREAK GRADE BREAK 627 627 6256246246256 2 5626 RIDGE626 FLOOR & DECOR 1 STORY 75,078 SF. FF = 629.50 10 9 8 43 8 12 12 6 12 12 11 PROP. DETENTION BASIN 100-YR WSE = 616.65 49.2'49.8'72.0'42.6'12.2'10.7'24" RCP33" RCP33" RCP33" RCP 33" RCP 33" RCP42" RCP 24" RCP 18" RCP 18" RCP42" R C P18" RCP4' FLUME EX. 15' STORM DRAINAGE EASEMENT (CCF NO. D212098905) EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 10' UTILITY EASEMENT (CAB.A. P. 11456 P.R.T.C.T.) EX. 15' UTILITY EASEMENT EX. 15' UTILITY EASEMENT EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. D212098905) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. 214218746) EX. 15' UTILITY EASEMENT (CCF NO. D212098905) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. VARIABLE WIDTH COMMON ACCESS EASEMENT (INST. NO. D206305192) EX. 29' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. 15' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. 214218746) 30' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 30' COMMON ACCESS, UTILITY (INST.AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 15' SANITARY SEWER EASEMENT (INST. NO. D214263624) 20' BUFFERYARD TYPE C 10' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 60' R.O.W. DEDICATION N00°10'55"W 592.90'N89°34'50"E237.38'S00°14'24"E 50.00'N89°34'50"E341.93'N00°02'16"W 372.29' S00°02'16"E 967.50'S89°48'13"W589.98'EX. 10' UTILITY EASEMENT (INST. NO. D214263624) STA. 0+23.86 LAT A-1 3'x3' LANDSCAPE INLET STA. 0+04.62 LAT A-2 6-GRATE INLET STA. 5+46.91 LINE A 4-GRATE INLET STA. 0+12.76 LINE A 3'x3' Y INLET STA. 0+00.00 LINE A CONNECT PROP. 42" RCP TO EX. STUB OUT STA. 0+65.92 LAT D 20' CURB INLET STA. 0+00.00 LAT D CONNECT PROP. 18" RCP TO EX. 30" RCP @ 60° STA. 0+55.25 LINE X FLARED WINGED HEADWALL W/ ORIFICE PLATE STA. 0+00.00 LINE X CONNECT PROP. 18" RCP TO EX. STUB OUT STA. 0+00.00 LINE C CONNECT TO EX. Y INLET STA. 0+07.51 LAT C-1 2-GRATE INLET STA. 2+03.07 LINE C 2-GRATE INLET STA. 0+37.80 LINE C = STA. 0+00.00 LAT C-2 4'x4' JUNCTION BOX W/ MH RISER STA. 2+01.72 LAT C-2 4-GRATE INLET PROP. 15' WATER EASEMENT PROP. 15' WATER EASEMENT 5' CURB CUT W/ FLUME 21" RCP EXISTING LEGEND: OHE EX. 8'' W EX. 8'' SS MAJOR CONTOUR LINE FENCE IRRIGATION CONTROL VALVE FIRE HYDRANT BOLLARD SIGN LIGHT POLE AIR CONDITIONING UNIT MANHOLE MONITORING WELL ELECTRIC METER SANITARY SEWER CLEANOUT WATER LINE GAS LINE MINOR CONTOUR LINE PROPERTY LINE OVERHEAD ELECTRIC WATER METER WATER VALVE VAULT FIRE DEPARTMENT CONNECTION GUY WIRE BILLBOARD POWER POLE GAS METER GROUND LIGHT SANITARY SEWER LINE UNDERGROUND TELEPHONE LINE UNDERGROUND COMMUNICATIONS LINE EX. GAS UGT UGC STORM SEWER LINE GRATE INLET LOT LINE EASEMENT LINE FENCE POST CURB INLET PRELIMINARY PAUL BARTEL 136395 P.E. NO. 8/17/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\ZONING SET\C5-STRM-54063.dwg DATE: August 17, 2023, TIME: 4:37 PM, USER: ah4133 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 AUGUST, 2023 CAD PB AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYCITY CASE NO.:ZA23-00427.801 AC., REMAINDER OF TRACTA (11.208 AC.) JOHN FREEMANSURVEY, ABSTRACT NO. 529STORM LINE CURB INLET GRATE INLET STORM JUNCTION BOX W/ MH RISER STORM DRAINAGE LEGEND 0 40'80' GRAPHIC SCALE - 1"=40'N6 STORM DRAINAGE PLAN ENGINEER HALFF ASSOCIATES, INC. 1201 N. BOWSER ROAD RICHARDSON, TX 75081 CONTACT: PAUL BARTEL EMAIL:PBARTEL@HALFF.COM TEL:(214)984-7321 OWNER FLOOR & DECOR 2500 WINDY RIDGE PKWY SE ATLANTA, GA 30339 CONTACT: PHILIP COCHRAN EMAIL:PHILIP.COCHRAN@FLOORANDDECOR.COM TEL:(770)617-4262 BENCHMARK LIST POINT #NORTHING (Y)EASTING (X)ELEVATION DESCRIPTION 101 7,027,898.05 2,392,603.80 629.77 SXTP 102 7,028,201.15 2,392,556.93 632.14 SXTP 103 7,028,809.76 2,392,598.36 617.94 SXTP EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINE EX. 8" WATER LINEEX. 6" WATER LINEEX. 6" WATER LINEEX. 8" WATER LINE EX. 8" WATER LINEEX. 8" WATER LINE EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8" SANITARY SEWER EX. 8" SANITARY SEWEREX. 8'x4' RCBC EX. 18" RCPEX. 36" RCPEX. 36" RCP EX. 24" RCPEX. 18" RCPEX. 42" RCP EX. 24" HDPE EX. 24" HDPEEX. 24" HDPE EX. 7'x5' RCBCEX. 18 " RCP EX. 8'x4' RCBC EX. 7'x5' RCBC EX. 30" RCP EX. 30" RCP EX. 18" RCPEX. 7'x5' RCBCEX. 7'x5' RCBC EX. 18" RCP EX. 7'x5' RCBC EX. 30" RCP EX. 21" RCPE X . 5 4 " RC P EX. 36" RCPEX. 30" RCP EX. 18" RCPEX. 42" RCPEX. U.G.E.EX. U.G.E.EX. U.G.E.EX. U.G.E. EX. U.G.E.EX. U.G.E.EX. 42" RCPEX. 8" WATER LINES. VILLAGE CENTER DRIVE (60' R.OW.) INSTR. NO. D214263624 LOT 1R, BLOCK 1 CARROLL ISD NO. 4 ADDITION CABINET A, SLIDE 13019 ZONING. CS LUD. PUBLIC/SEMI-PUBLIC LOT 1R, BLOCK 1 GATEWAY CHURCH ADDITION CABINET A, SLIDE 7866 ZONING. CS LUD. OFFICE COMMERCIAL LOT 1, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL LOT 2, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL 339,859 SQ. FT. OR 7.802 ACRES (REMAINDER OF A CALLED 11.208 ACRE TRACT) GREENWAY-1709/ELEVEN PARTNERS, L.P. INST. NO D197109628 LOT 1, BLOCK 1KIMBALL CROSSINGCFF. NO. D212098905ZONING. SP1LUD. RETAIL COMMERCIALLOT 1, BLOCK 1ETHAN ALLEN 1709 ADDITIONCAB. A, P, 11456INST. NO. D206305193ZONING. SP1LUD. RETAIL COMMERCIALFLOOR & DECOR 1 STORY 75,078 SF. FF = 629.50 10 9 8 43 8 12 12 6 12 12 11 PROP. DETENTION BASIN 100-YR WSE = 616.65 FIRE HYDRANT FIRE HYDRANT FIRE HYDRANT FIRE HYDRANT FIRE HYDRANT REMOVE EX. STUB AND CONNECT TO EX. 8" PVC REMOVE EX. STUB AND CONNECT TO EX. 8" PVC 8" FIRE 2" DOM 2" DOM. METER & BACKFLOW PREVENTER 2" IRR. METER & BACKFLOW PREVENTER 49.2'49.8'72.0'42.6'10.7' EX. 15' STORM DRAINAGE EASEMENT (CCF NO. D212098905) EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 10' UTILITY EASEMENT (CAB.A. P. 11456 P.R.T.C.T.) EX. 15' UTILITY EASEMENT EX. 15' UTILITY EASEMENT EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. D212098905) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. 214218746) EX. 15' UTILITY EASEMENT (CCF NO. D212098905) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. VARIABLE WIDTH COMMON ACCESS EASEMENT (INST. NO. D206305192) EX. 29' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. 15' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. 214218746) 30' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 30' COMMON ACCESS, UTILITY (INST.AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 15' SANITARY SEWER EASEMENT (INST. NO. D214263624) 20' BUFFERYARD TYPE C 10' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 60' R.O.W. DEDICATION N00°10'55"W 592.90'N89°34'50"E237.38'S00°14'24"E 50.00'N89°34'50"E341.93'N00°02'16"W 372.29' S00°02'16"E 967.50'S89°48'13"W589.98'EX. 10' UTILITY EASEMENT (INST. NO. D214263624) FDC 8" PVC2-WAY 8" CLEANOUT REMOVE EX. 8" PLUG & CONNECT PROP. 8" PVC TO EX. 8" PVC PROP. 15' WATER EASEMENT PROP. 15' WATER EASEMENT PROP. 15' WATER EASEMENT PROP. 15' WATER EASEMENT12.2'53.4'8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR0+001+002+003+004+005+006+00 7+00 8+009+0010+0011+0012+0012+818'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTR8'' WTRFDC 0+001+00 DCO8'' WW71.2'PROP. GUARDRAIL PROTECTING RISER (INTERNAL WITHIN BUILDING) 32.73' APPROXIMATE WATER RISER LOCATION (INTERNAL WITHIN BUILDING) EXISTING LEGEND: OHE EX. 8'' W EX. 8'' SS MAJOR CONTOUR LINE FENCE IRRIGATION CONTROL VALVE FIRE HYDRANT BOLLARD SIGN LIGHT POLE AIR CONDITIONING UNIT MANHOLE MONITORING WELL ELECTRIC METER SANITARY SEWER CLEANOUT WATER LINE GAS LINE MINOR CONTOUR LINE PROPERTY LINE OVERHEAD ELECTRIC WATER METER WATER VALVE VAULT FIRE DEPARTMENT CONNECTION GUY WIRE BILLBOARD POWER POLE GAS METER GROUND LIGHT SANITARY SEWER LINE UNDERGROUND TELEPHONE LINE UNDERGROUND COMMUNICATIONS LINE EX. GAS UGT UGC STORM SEWER LINE GRATE INLET LOT LINE EASEMENT LINE FENCE POST CURB INLET PRELIMINARY PAUL BARTEL 136395 P.E. NO. 8/17/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\ZONING SET\C6-WWW-54063.dwg DATE: August 17, 2023, TIME: 4:38 PM, USER: ah4133 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 AUGUST, 2023 CAD PB AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYCITY CASE NO.:ZA23-00427.801 AC., REMAINDER OF TRACTA (11.208 AC.) JOHN FREEMANSURVEY, ABSTRACT NO. 529WATER PIPE FIRE HYDRANT VALVE TEE FDC BENDS PLUG REDUCER WATER METER BACKFLOW PREVENTOR WATER & WASTEWATER LEGEND WASTEWATER PIPE WASTEWATER MANHOLE 2-WAY CLEANOUTDCO FDC 0 40'80' GRAPHIC SCALE - 1"=40'N7 SITE UTILITY PLAN OWNER FLOOR & DECOR 2500 WINDY RIDGE PKWY SE ATLANTA, GA 30339 CONTACT: PHILIP COCHRAN EMAIL:PHILIP.COCHRAN@FLOORANDDECOR.COM TEL:(770)617-4262 ENGINEER HALFF ASSOCIATES, INC. 1201 N. BOWSER ROAD RICHARDSON, TX 75081 CONTACT: PAUL BARTEL EMAIL:PBARTEL@HALFF.COM TEL:(214)984-7321 BENCHMARK LIST POINT #NORTHING (Y)EASTING (X)ELEVATION DESCRIPTION 101 7,027,898.05 2,392,603.80 629.77 SXTP 102 7,028,201.15 2,392,556.93 632.14 SXTP 103 7,028,809.76 2,392,598.36 617.94 SXTP S. VILLAGE CENTER DRIVE (60' R.OW.) INSTR. NO. D214263624 LOT 1R, BLOCK 1 CARROLL ISD NO. 4 ADDITION CABINET A, SLIDE 13019 ZONING. CS LUD. PUBLIC/SEMI-PUBLIC LOT 1R, BLOCK 1 GATEWAY CHURCH ADDITION CABINET A, SLIDE 7866 ZONING. CS LUD. OFFICE COMMERCIAL LOT 1, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL LOT 2, BLOCK 1 KIMBALL OAKS ADDITION INST. NO. D214263624 ZONING. SP1 LUD. RETAIL COMMERCIAL E. SOUTHLAKE BOULEVARD (F.M. 1709) (Variable Width R.OW.)LOT 1, BLOCK 1KIMBALL CROSSINGCFF. NO. D212098905ZONING. SP1LUD. RETAIL COMMERCIALLOT 1, BLOCK 1ETHAN ALLEN 1709 ADDITIONCAB. A, P, 11456INST. NO. D206305193ZONING. SP1LUD. RETAIL COMMERCIALEX. 24' C.A.E.(CAB. "A", PG. 11456P.R.T.C.T.)EX. 50' BUILDING SETBACKEX. 20' C.A.E. (INST. NO. D206305192) EX. 15' STORM DRAINAGE EASEMENT (CCF NO. D212098905) EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 10' UTILITY EASEMENT (CAB.A. P. 11456 P.R.T.C.T.) EX. 15' UTILITY EASEMENT EX. 15' UTILITY EASEMENT EX. 20' STORM DRAINAGE EASEMENT (V. 14983, 405 D.R.T.C.T.) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. D212098905) EX. 15' STORM DRAINAGE EASEMENT (INST. NO. 214218746) EX. 15' UTILITY EASEMENT (CCF NO. D212098905) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. VARIABLE WIDTH COMMON ACCESS EASEMENT (INST. NO. D206305192) EX. 29' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT (INST. NO. D214263624) EX. 15' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. 214218746) 30' COMMON ACCESS, UTILITY AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 30' COMMON ACCESS, UTILITY (INST.AND DRAINAGE EASEMENT (INST. NO. D214263624) EX. 15' SANITARY SEWER EASEMENT (INST. NO. D214263624) EX. 10' UTILITY EASEMENT EX. 15' SANITARY SEWER EASEMENT EX. 20' PIPELINE EASEMENT 20' BUFFERYARD TYPE C 10' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 20' BUFFERYARD TYPE B 60' R.O.W. DEDICATION N00°10'55"W 592.90'N89°34'50"E237.38'S00°14'24"E 50.00'N89°34'50"E341.93'N00°02'16"W 372.29' S89°34'26"W 30.00' N00°02'16"W 50.00' N89°34'26"E 42.00' S00°02'16"E 967.50'S89°48'13"W589.98'EX. 10' UTILITY EASEMENT (INST. NO. D214263624) FDC 10 9 8 43 8 12 12 6 12 12 11 PROP. DETENTION BASIN 100-YR WSE = 616.65 339,859 SQ. FT. OR 7.802 ACRES (REMAINDER OF A CALLED 11.208 ACRE TRACT) GREENWAY-1709/ELEVEN PARTNERS, L.P. INST. NO D197109628 FLOOR & DECOR 1 STORY 75078 SF. FF = 629.50 CONCRETE PAVEMENT EX. SIDEWALK PROP. 8' SIDEWALK PROP. 8.5' SIDEWALK PROP. 5' SIDEWALK PUBLIC ROAD(FM 1709)PRELIMINARY PAUL BARTEL 136395 P.E. NO. 8/17/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\ZONING SET\C7-PEDESTRIAN ACCESS-54063.dwg DATE: August 17, 2023, TIME: 4:38 PM, USER: ah4133 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 AUGUST, 2023 CAD PB AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYCITY CASE NO.:ZA23-00427.801 AC., REMAINDER OF TRACTA (11.208 AC.) JOHN FREEMANSURVEY, ABSTRACT NO. 5290 40'80' GRAPHIC SCALE - 1"=40'N8 PEDESTRIAN & SITE CIRCULATION PLAN BENCHMARK LIST POINT #NORTHING (Y)EASTING (X)ELEVATION DESCRIPTION 101 7,027,898.05 2,392,603.80 629.77 SXTP 102 7,028,201.15 2,392,556.93 632.14 SXTP 103 7,028,809.76 2,392,598.36 617.94 SXTP OWNER FLOOR & DECOR 2500 WINDY RIDGE PKWY SE ATLANTA, GA 30339 CONTACT: PHILIP COCHRAN EMAIL:PHILIP.COCHRAN@FLOORANDDECOR.COM TEL:(770)617-4262 ENGINEER HALFF ASSOCIATES, INC. 1201 N. BOWSER ROAD RICHARDSON, TX 75081 CONTACT: PAUL BARTEL EMAIL:PBARTEL@HALFF.COM TEL:(214)984-7321 LEGEND CUSTOMER/CLIENT/MAINTENANCE ENTRANCE & EXIT PEDESTRIAN ACCESS PATH DELIVERY ENTRANCE & EXIT BCD643251AEF55'-0"41'-1"49'-11"49'-11"49'-11"49'-11"39'-6"46'-6 3/4"GASTBD2" WATERFIRE321'-6 3/4"NORTH1SHELL PLANSCALE: 1/16" = 1'-0"9'-0" W x 9'-0" H 3'-6"6'-2 1/2" 3'-4" 3'-6" W x 3'-6" H @ 4'-0" AFF 9'-0" W x 9'-0" H CO/NO2CONTROLLERASSUMED STOCKROOMGATE LOCATION, STOREPLANNING TO CONFIRMCENTER ROOFRIDGETOTAL BUILDINGAREA:75,078 SFLOAD DOCKRAMP DN.CPU CANOPYBTM. OF CANOPY@ 10'-6" AFFHIGHWAYGUARDRAILENTRANCE CANOPYBTM. OF CANOPY @ 12'-6" AFFZERO CURBLOADING ZONEHOSE BIB ANDDISPLAY BUILD AREA7628627628629 628 626627628 623 6246256626627625 7.18199'-8"55'-0"55'-0"55'-0"46'-6 3/4"238'-2" 38'-10"105'-3 1/4"8"32'-0" W x 14'-0" H8'-6 1/2"7'-11 1/2"104A104101A102A102C102D103A103B103C103D103ECPU W/ ICE MAKER129'-11 1/4"4'-3 1/2"CASH113149 SFTRAININGROOM110285 SFSTORAGE11763 SFASSISTANTMANAGER1161717 SFCORRIDOR 2111243 SFSIGNROOM11462 SFCEM112111 SFMEN'S105221 SFWOMEN'S106221 SFJANITOR107109 SFDATAROOM11572 SFCORRIDOR 110860 SF100'-8 3/8"29'-4 1/4"48'-6 3/4"27-9" 77'-4" 3'-4 1/2" W x 7'-2 1/4" H3'-4 1/2" W x 7'-2 1/4" H3'-4 1/2" W x 7'-2 1/4" H4" SANITARY14'-0"52'-9"ZERO CURB120'-0"3'-4 1/2" W x 7'-2 1/4" H10'-0" HIGHMASONRYSCREEN WALL4" SANITARY5'-5 3/4"4'-0" TOWERBUMPOUTELEMENT4'-0" TOWERBUMPOUTELEMENT35'-9 1/2"30'-0"28'-9 1/4"30'-0"37'-6"55'-0"102E3'-4 1/2" W x 7'-2 1/4" H95'-6"123'-3 3/8"LOUNGE118184 SFBREAKROOM109431 SF16'-0 1/2" W x 8'-0 1/2" HIDF CABINET ABOVEMTD. ON WALL @12'-0" AFFRECESSED ELECTRICPANELCOLUMN TYP.7'-0"103F77'-5 1/4"77'-7 1/2"MASONRYSCREENING WALL19'-2 1/2"116'-7 1/4"102B102A3'-4 1/2" W x 7'-2 1/4" H34'-1 1/2"20'-0"35'-9 1/2"38'-1"30'-0"35'-9 1/2"ELECTRICALTRANSFORMERLOCATIONTBD30'-0"63'-10"20'-0"63'-10"RECYCLINGDUMPSTERENCLOSURETBD368'-1 3/8"PROPANESTORAGETHIN BRICKVENEER BUMPOUTELEMENTTYP. 3'-5" x 4'-0"2'-8 1/2"3'-4 1/2"30'-0"35'-9 1/2"35'-9 1/2"THIN BRICK VENEERPILASTER F&D TYP.1'-0" DEPTHDESIGN TO MATCHBUMPOUT ELEMENT35'-9 1/2"32'-2 1/4"35'-9 1/2"35'-9 1/2"35'-9 1/2"17'-1 3/8"3'-5"THIN BRICK VENEERBUMPOUT ELEMENTCORNER - 4'-0" x 4'-0"39'-2 1/2"39'-2 1/2"39'-2 1/2"37'-6"37'-6"CPU104579 SF3'-4 1/2" W x 7'-2 1/4" H 3'-4 1/2" W x 7'-2 1/4" H 3'-4 1/2" W x 7'-2 1/4" H STOCKROOM10312,957 SFSALES10258,004 SFCPU BAY104A624 SFDESIGNCENTER119MASONRYSCREENING WALLBASE PLAN CHECKLISTNUMBERITEMCOMMENTSTORE PLANNING CHECKLIST 1STOREFRONT ELEVATION2SHELL BASE PLAN3OFFICE PACKAGE / PUBLIC RESTROOMS LOCATED (NOTE IF ITCAN'T BE MOVED) SHOW ROOM NAMES IN OFFICE PACKAGEWITH SQUARE FOOTAGE4SHOW CUSTOMER LOAD AREA WITH CANOPY (NOTE IF IT CAN'TBE MOVED). ALSO SHOW DOUBLE SLIDE DOORS FOR CUSTOMERENTRANCE TO CUSTOMER PICK UP (WITH 93" EGRESS WIDTH).CUSTOMER LOAD-OUT DOOR OPENING SHOULD BE 12'X10'(UNLESS OTHERWISE REQUESTED)5LOADING DOCKS LOCATED6SHOW COMPACTOR LOCATION. VERIFY LOCATION OF 3'-6" X 3'-6"COMPACTOR DOOR WITH DIMENSIONS7SHOW ALL ELECTRICAL - PANELS, TRANSFORMERS, ETC. INSIDEAND OUTSIDE. SHOW STRIPING. (NOTE IF IT CAN'T BE MOVED)8IDF CABINET (NOTE IF IT CAN'T BE MOVED)9PROPANE STORAGE LOCATED10INDICATE CEILING HEIGHT - FROM FLOOR TO LOWEST POINT ATSALES AND STOCKROOM(i.e. SPRINKLER MAINS, ELECTRICALCOMPONENTS, BAR JOISTS, HVAC, ETC.)11TOTAL SQUARE FOOTAGE NOTED12VESTIBULE POSITION (NOTE IF IT CAN'T BE MOVED)13VERIFY ALL EXTERIOR PENETRATIONS AND EGRESS DOORS WITHDIMENSIONS (NOTE IF ANY CAN,T BE MOVED)14COUNTERTOP STORAGE - IS IT ALLOWED OUTSIDE, IF SO SHOW ITON BASE PLAN15CART STORAGE - CAN SHOPPING CARTS BE STORED OUTSIDE?16SEISMIC RACKING REQUIRED?NO17REC APPROVED18GO DATE1990% CHECK SET DATE20PRELIMINARY DRAWING DUE DATE21OTHER (I.E. FLOOR LOAD ISSUES, STRUCTURAL BRACING, ETC.) IFSO, NOTE ON PLAN.ARCHITECT CHECKLIST 22INDICATE TRUE NORTH ON BASE PLAN23JUSTIFY LOWER LEFT INTERIOR CORNER OF BUILDING TO 0,0.ENTRANCE NEEDS TO FACE BOTTOM OF PAGE (ROTATE IF NOT).24SHOW ALL PLUMBING - RISERS, PUMP ROOMS, FIRE MAIN, ALARMPANELS (SHOW STRIPING), CLEANOUTS, SANITARY SEWERS ANDROOF DRAINS, PIPING25SHOW ACTUAL SIZE AND SHAPE OF ALL COLUMNS ON BASE PLAN.INCLUDE COLUMN GRID LINES AND COLUMN GRID INDICATORSWITH DIMENSION STRINGS26SHOW ALL PLUMBING, MILLWORK, AND ACCESSORIES IN THEOFFICE PACKAGE27IF APPLICABLE, INDICATE ZERO CURB ADJACENT TO MAINENTRANCE AND CUSTOMER/PRO ENTRANCE (ADVISE IF/WHENRAMP IS NEEDED).28SHOW 7X3 DOOR ADJACENT TO DOCK DOORS FOR TRUCKDRIVERS.29INDICATE ROOF ACCESS LOCATION (NEW OR EXISTING)30INCLUDE CORRECT CITY, STATE CODE IN BOTH EGRESS AND SALESEGRESS CALCULATIONS√√√√√√√√√√√√√√√√DALLAS [SOUTHLAKE], TEXAS ADOPTED CODES2021 International Building Code2021 International Mechanical Code2021 International Electrical Code2021 International Energy Conservation Code2021 International Fuel Gas Code2021 International Fire Code2021 International Plumbing Code*With AHJ Admendments.2021 Building Codes adopted as of May 1, 2022√√√NOTE:CEILING HEIGHT TO BE DESIGNEDTO PROTOTYPICAL MINIMUMNOTE:SEISMIC DESIGN CATEGORY "A"RISK CATEGORY II√NOTE:CONSTRUCTION TYPE IIB WITHAUTOMATIC SPRINKLER SYSTEMNOTE:IECC CLIMATE ZONE 2ADRAWN:CHECKED:SHEETSEALISSUEGROSS BLDG AREA:JOB NUMBER: ISSUE DATE:STORE NUMBER:PROTOTYPE: 2500 WINDY RIDGEPARKWAY, SE ATLANTA, GA 30339CODE CONSULTANTS, INC.ST. LOUIS, MISSOURI 63146-42352043 WOODLAND PKWY, SUITE 300314-991-2633TMCONSULTING STRUCTURAL ENGINEERSScottsdale, Arizona 85251Phone: (602) 265-4331 Fax: (480) 663-1788A.V. SCHWAN & ASSOCIATES6000 E. Thomas Road, Suite 1Website: www.AVSchwan.comSBLM Architects33 Walt Whitman Road, Suite 300AHuntington Station, NY 11746Telephone 631 683 5588Fax 631 683 559102303675,120 SFT.B.D.T.B.D.2023 Q12185 E Southlake Blvd,Dallas [Southlake], TX 76092Dallas [Southlake], TX STORE #TBD HALFF ASSOCIATES, INC.711 N. CARANCAHUA ST., SUITE 1190CORPUS CHRISTI, TX 78401TELEPHONE: 361-400-0981Eric SeversonQuestions For dlb Call:Phone:dlb associatesCONSULTING ENGINEERS, P.C.(732) 774-20003600 Rt 66, Suite 150 #5981,Neptune, N.J. 07753SHELL PLANSHELLTMHRR; JHZONING SUBMISSION08/21/23CITY CASE NO. ZA23-0042 00000000 00000000 00000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000011111 11111111 11111111 11111111 111111111 11111111 11111111 1111111111111111111111111111111111222223333333333333322221111111111345445676666876667765544321111111111124786781012109910121099911109877632211221111111136911912141213131415131313151512121113151186422222222111111369137131493432223432211111125814754223454322111112688543345754322111125811444345787532211112578106233346810864321111245691173333468975422111123457866533467543221111113471096533356433221111124714564333454332211111257121433334443322111112571055433344433221113688965333454332211136887653345653322111258956433568643221112571276534689864321112581486534681086432111257114543457875322111258912223457543221113688122233454322211126881222334443222111257101222334433222111258131222334443222111258143332334543222111358116653335653322111369109653346864322111137109775446898643211124691077644689864321113568129653457865322111467813554334565332211157771022222345432211111798871122223332211111279881013141064459141275459141395432223222111111687810121310876810121198789121298543333332211114667777777777777777777775445665432211134454444454444445554444444568875321112222222222222222222222222234554321111111111111111111111111111111000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001616W @ 12'W2 @ 20'W2 @ 20'W2 @ 20'W2 @ 20'W2 @ 20'W2 @ 20'W2 @ 20'S2HS @ 35'W2 @ 20'W2 @ 20'W2 @ 20'W2 @ 20'W2 @ 20'W @ 17'W @ 17'W @ 17'W @ 17'S4-2 @ 35'S4-2 @ 35'S4-2 @ 35'S2HS @ 35'W @ 17'W @ 17'Plan ViewScale - 1" = 30ftFloor & DecorSouthlake TX (Dallas)Site Lighting PhotometricDesignerSCDate07/28/2023ScaleNot to ScaleDrawing No.REV1Summary1 of 1Luminaire LocationsNo. Label X Y ZLocationMH Orientation Tilt X YAimZ1 S2HS 2384.77 -451.25 35.00 35.00 0.00 0.00 2384.77 -450.000.002 S2HS 2444.19 -94.79 35.00 35.00 270.00 0.00 2442.94 -94.790.001 S4-2 2066.26 -92.86 35.00 35.00 0.00 0.00S4-2-1 2066.26 -90.03 35.00 35.00 0.00 0.00 2066.26 -91.45 0.00S4-2-2 2066.26 -95.69 35.00 35.00 180.00 0.00 2066.26 -94.28 0.002 S4-2 2194.41 -92.86 35.00 35.00 0.00 0.00S4-2-1 2194.41 -90.03 35.00 35.00 0.00 0.00 2194.41 -91.45 0.00S4-2-2 2194.41 -95.69 35.00 35.00 180.00 0.00 2194.41 -94.28 0.003 S4-2 2326.50 -92.29 35.00 35.00 0.00 0.00S4-2-1 2326.50 -89.46 35.00 35.00 0.00 0.00 2326.50 -90.88 0.00S4-2-2 2326.50 -95.12 35.00 35.00 180.00 0.00 2326.50 -93.71 0.001 W 2059.67 -406.04 12.00 12.00 90.00 0.00 2059.67 -406.04 0.002 W 2035.93 -179.87 17.00 17.00 0.00 0.00 2035.93 -179.87 0.003 W 2100.39 -179.97 17.00 17.00 0.00 0.00 2100.39 -179.97 0.004 W 2152.69 -179.81 17.00 17.00 0.00 0.00 2152.69 -179.81 0.006 W 2339.61 -179.10 17.00 17.00 0.00 0.00 2339.61 -179.10 0.001 W2 2116.98 -382.25 20.00 20.00 180.00 0.00 2116.98 -382.250.002 W2 2197.07 -382.05 20.00 20.00 180.00 0.00 2197.07 -382.050.003 W2 2277.01 -381.66 20.00 20.00 180.00 0.00 2277.01 -381.660.004 W2 2350.37 -381.45 20.00 20.00 180.00 0.00 2350.37 -381.450.005 W2 2390.75 -368.38 20.00 20.00 90.00 0.00 2390.75 -368.38 0.006 W2 2390.26 -279.79 20.00 20.00 90.00 0.00 2390.26 -279.79 0.007 W2 2389.74 -194.18 20.00 20.00 90.00 0.00 2389.74 -194.18 0.008 W2 2038.63 -422.21 20.00 20.00 180.00 0.00 2038.63 -422.210.009 W2 2016.23 -397.08 20.00 20.00 270.00 0.00 2016.23 -397.080.0010 W2 2015.78 -336.99 20.00 20.00 270.00 0.00 2015.78 -336.99 0.0011 W2 2015.21 -276.71 20.00 20.00 270.00 0.00 2015.21 -276.71 0.0012 W2 2014.85 -212.27 20.00 20.00 270.00 0.00 2014.85 -212.27 0.008 W 2193.50 -179.63 17.00 17.00 0.00 0.00 2193.50 -179.63 0.009 W 2304.11 -179.41 17.00 17.00 0.00 0.00 2304.11 -179.41 0.00StatisticsDescription Symbol Avg Max Min Max/Min Avg/MinProperty Boundaries (within) 3 fc 16 fc 0 fc N/A N/AProperty Line 0 fc 1 fc 0 fc N/A N/AExisting Lighting Survey Notes1. Readings are shown in units of maintained footcandles.2. Total Light Loss Factor (LLF) = Estimated to accurately reflect measured light level calculations3. Test Plane = 0' AFF4. Fixture Mounting Height = 35' AG for all pole-mounted area lights, 17' AG for W wall packs, 20' AG for W2 wall packs.5. Building Height = 30' AFF6. Building Reflectance Value = 10/10/107. Fixture Spacing = See Fixture Locations Schedule8. This photometric layout was calculated using specific criteria. Any deviation from stated parameters will affect actual performance.9. These lighting calculations are not a substitute for independent engineering analysis of lighting system suitability and safety.ScheduleSymbol Label Image Quantity Manufacturer Catalog Number DescriptionLumensPer LampLight LossFactorWattageS2HS2 Lithonia Lighting RSX2 LED P6 40K R2 HS RSX LED Area Luminaire Size 2 P6 LumenPackage 4000K CCT Type R2 Distributionwith HS shield22965 0.92 246.63S4-23 Lithonia Lighting RSX3 LED P4 40K R4 RSX Area Fixture Size 3 P4 Lumen Package4000K CCT Type R4 Distribution40976 0.92 623.84W7 Lithonia Lighting KAXW LED P3 40K R4MVOLTWall Pack (used in front of building) 9707 0.92 79W212 Lithonia Lighting RSX3 LED P4 40K R3 Wall Mounted Area Light (used alongrear/sides of building)40446 0.92 311.9208/21/2023 36625491v.4 S-P-1 (Detailed) Site Plan District Land Use Regulations 2185 East Southlake Blvd This site shall comply with all conditions of the City of Southlake Comprehensive Zoning Ordinance No. 480, as amended, as it pertains to the “B-1 Business Service District” regulations, with the following exceptions: Permitted Uses: The following uses shall be permitted in addition to what is permitted in the base B-1 Business Service District:  All “C-3 General Commercial District” uses  Single tenant, owner or business occupancy exceeding sixty thousand (60,000) square feet  Warehouse Outside Storage: The outdoor storage of propane gas for sale or rent shall be allowed as conceptualized on the Site Plan, and shall be screened using Masonry Screening Walls as and roughly where indicated on the Site Plan. Building Color Standards (Variance): The use of Regal Red (RAL 3020) on a non-residential building is permitted, provided that the use of such color is limited to metal coping, canopies, and signage on the building. No more than five percent (5%) of Regal Red (RAL 3020) will be used per façade. Parking (Alternative Standard per Parking Study): In accordance with the Parking Study, maximum parking observed for the proposed use (based on peak use) is 0.91 parking spaces per 1,000 BSF (1 space per 1,098 BSF). This peak need per the parking study is the basis for the Minimum Required Parking for the property: 70 parking spaces. Additional parking spaces may be provided but are not required. Driveways (Variance): Under the current City of Southlake Driveway Ordinance (Ordinance 634, Section 5, Table 1) drive accesses should be separated from “intersecting” public ROW by a minimum of 100 feet. The proposed Site Plan proposes 2 drives accessing a shared private mutual access easement/drive which aligns north-south connecting on the north to FM 1709/Southlake Boulevard and on the south to Village Center Drive. The southernmost proposed drive is directly aligned with the existing drive immediately opposite, servicing the Marshall’s/PGA (Kimball Oaks) site – and is approximately 41.5 feet from the Village Center ROW. In the case of the proposed development, 36625491v.4 which is an “in-fill” development surrounded on all 4 sides by existing fully constructed sites/improvements, and where the site access and operation are expected to follow certain functional realities, the following considerations (more specifically discussed with the TIA supporting the subject property development) justify the southerly drive location as shown on the Site Plan:  The proposed south driveway aligns with the existing driveway on the east side of the north-south drive aisle. Shifting the south driveway to the north to meet the City’s spacing standard would result in the driveway being offset from the Marshalls / PGA Superstore driveway.  The proposed south driveway is expected to be a low volume driveway, as it runs along the back (south) side of the Floor & Decor building. Customer activity will be focused at the north driveway, which provides direct access to the primary parking lot and the store entrance, both located on the north side of the building.  Trucks serving the Floor & Decor store will primarily use FM 1709, turn into the north Floor & Decor site driveway, circulate counterclockwise around the building to access the loading dock on the south side of the building, and exit the south driveway back towards FM 1709. Internally, this operation plan eliminated conflict between the passenger vehicle parking maneuver and truck delivery or maintenance routes, and eliminates truck stacking from the “separation” provision.  During typical weekday peak hours, trips accessing the Floor & Decor store from Village Center Drive are expected to be minimal. Halff estimates five percent (5%) of the Floor & Decor trips will use Village Center Drive to access the site, with the remaining 95% of the trips utilizing access connections to FM 1709 and Kimball Avenue. With this expected distribution, the number of trips using the south driveway connection to the north-south drive aisle are expected to be very low, which should have minimal impacts to traffic flow along Village Center Drive. Building Height: The underlying B-1 Business Service District allows for a maximum building height of 35 feet, and within 100 feet of the nearest residential property, a maximum of 20 feet. The 20 feet height limitation within residential proximity will remain, and maximum building height elsewhere shall be 40 feet, which includes any architectural features. Tree Removal Mitigation: The current tree protection ordinance allows for payment in lieu of protection where protected trees cannot be maintained due to site and development realities, as a mitigation feature. The site will follow the ordinance allowed approach of payment into the City’s Forestry Fund for an equivalent number of caliper inches of protected trees which are anticipated to be removed from the site due to development. 36625491v.4 Tree Canopy Protection Deviation – Mitigation Proposed: Per Ordinance, based on the existing cover for the undeveloped site, 60% of the existing tree cover is the target for the site. Due to the location of trees on the site being within the necessary development area, the target 60% existing canopy coverage cannot be met. In order to mitigate for the existing tree canopy removal as outlined on the Tree Conservation Plan and Landscape Plan, new canopy tree species will be planted that, at maturity, will provide approximately 22% greater canopy coverage than the minimum required existing canopy coverage per City Ordinance. Additionally, at time of new tree plantings, all bufferyard canopy trees are proposed to be increased to 6” caliper to provide for a larger initial canopy coverage and visual impact. Landscape Plan Variance – Mitigation Proposed: The required landscaping for this development will be provided in accordance with the Landscape Plan. Due to site spatial constraints and conflicts with existing utilities and drainage structures, the full number of tree plantings could not be provided in the north and west bufferyards. In order to mitigate for this, all bufferyard canopy trees have been upsized from 4” caliper to 6” caliper, and an additional tree has been added in the east bufferyard. The net result of this upsizing of the bufferyard canopy trees at initial planting is that the same caliper inches of trees have been provided as are required per the base ordinance requirements. Traffic On-Site Circulation: The traffic and truck circulation on-site has been depicted on the Pedestrian and Site Circulation Plan. Primary customer, delivery, and site maintenance (trash pickup, etc.) traffic will be directed to the northernmost driveway (regardless of Public ROW origin of traffic). Delivery and maintenance traffic will proceed around the building in a counter-clockwise fashion and will exit the southerly drive, with the expectation of re-entering Public ROW at FM 1709 (Southlake Blvd.). Traffic Signage: Additional traffic signage will be placed on the property:  Inside the “Customer Pick Up” area, there will be signage noting the school drop off and pick up hours and encourage avoiding Village Center Drive during the hours of 7:30 AM – 8:30 AM and 3:00 PM – 4:30 PM. The sign will note school hours 45 minutes before school opens and 30 minutes after school closes.  School Zone signage will be placed on the private drive in accordance with TMUTCD standards. 36625491v.4 Conformance with the Pathways Master Plan: As the trail location (vertically and horizontally) must integrate with the design for Village Center Drive (which will not be constructed with the proposed development), the proposed development does not expect to construct the full trail continuation at this time. The applicant/developer expects to participate in the construction cost of the trail coincident with the development frontage of Village Center Drive, minus the construction value of the trail portion being constructed to connect the proposed development with pedestrian path within Public ROW. The appropriate remaining trail value (coincident with the property) can be escrowed for use by the City or other similar vehicle can be established as provided by the City. Parking and Trip Generation Study Floor & Decor Prepared for: Floor and Decor Outlets of America, Inc. Prepared by: Kimley-Horn and Associates, Inc. 12740 Gran Bay Parkway West, Suite 2350 Jacksonville, Florida 32258 ©Kimley-Horn and Associates, Inc. May 2023 Parking and Trip Generation Study Floor & Decor Prepared for: Floor and Decor Outlets of America, Inc. Prepared by: Kimley-Horn and Associates, Inc. 12740 Gran Bay Parkway West, Suite 2350 Jacksonville, Florida 32258 ©Kimley-Horn and Associates, Inc. May 2023 This item has been digitally signed and sealed by: on the date adjacent to the signature. Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies Floor & Decor Parking and Trip Generation Study Page i May 2023 TABLE OF CONTENTS Page Introduction .................................................................................................................................1 Data Collection............................................................................................................................1 Results of Parking Data Collection ............................................................................................11 Results of Trip Generation Data Collection ...............................................................................11 Summary ..................................................................................................................................14 Trip and Parking Rate Comparisons .........................................................................................15 Appendix A: Sample Parking and Trip Generation Data Collection Sheets Appendix B: Parking Data Collection Appendix C: Trip Generation Data Collection LIST OF FIGURES Page Figure 1: Doral Store Location Map .............................................................................................3 Figure 2: Alexandria Store Location Map ....................................................................................4 Figure 3: Pompano Beach Store Location Map ...........................................................................5 Figure 4: Farmingdale Store Location Map .................................................................................6 Figure 5: North Charleston Store Location Map ..........................................................................7 Figure 6: Avon Store Location Map .............................................................................................8 Figure 7: Cypress Store Location Map ........................................................................................9 Figure 8: Tuckwila Store Location Map .....................................................................................10 LIST OF TABLES Page Table 1: Peak Parking Counts and Rates .................................................................................12 Table 2: Peak Hour Trip Generation Summary .........................................................................13 Table 3: Average Parking and Trip Generation Rates ..............................................................14 Table 4: Highest Parking and Trip Generation Rates ................................................................14 Table 5: Trip Generation Rate Comparison ...............................................................................15 Table 6: Parking Rate Comparison ...........................................................................................16 Floor & Decor Parking and Trip Generation Study Page 1 May 2023 Introduction Floor and Decor Outlets of America, Inc. has retained Kimley-Horn and Associates, Inc. (Kimley- Horn) to determine actual parking and trip generation rates at several Floor & Decor stores around the country. Due to the characteristics of Floor & Decor’s products, the sizes of the stores are very large in comparison to other retail stores, typically ranging between 60,000 and 100,000 square feet. The stores are sized to accommodate the large amount of flooring inventory that is typically stored and displayed for sale within the store. Historically, in order to determine the trip generation and required parking for a proposed Floor & Decor store, municipalities have used parking and trip generation rates that are based on studies for more traditional commercial retail stores. These traditional retail rates tend to overestimate the parking spaces needed and the weekday peak hour trips generated by a Floor & Decor store. This can result in Floor & Decor incurring unnecessary costs associated with constructing under -utilized parking lots for its stores and over-assessment for off-site transportation mitigation or mobility fees. Kimley-Horn has recently conducted parking and trip generation data collection for several existing Floor & Decor stores around the country. From the data collection, actual parking and trip generation rates were determined for the existing stores on a per thousand square feet basis. This report summarizes the data collection and resulting parking and trip generation rates . Data Collection Parking and trip generation data was collected for eight existing Floor & Decor stores around the country. Per Floor & Decor, these eight sites represent the best performing stores in each of their respective markets and were selected a s the stores anticipated to have the highest parking and trip generation rates, representing a “worst -case” scenario. The store locations are as follows: 1. Doral: 2525 NW 82nd Avenue; Doral, FL, 33122 2. Alexandria: 4607 Eisenhower Avenue; Alexandria, VA 22304 3. Pompano Beach: 1914 W Atlantic Boulevard; Pompano Beach, FL 33069 4. Farmingdale: 1002 Broad Hollow Road; Farmingdale, NY 11735 5. North Charleston: 6029 Rivers Avenue; Charleston, SC 29406 6. Avon: 80 Stockwell Drive; Avon, MA 02322 7. Cypress: 20502 Hempstead Road; Houston, TX 77065 8. Tuckwila: 17651 Southcenter Parkway; Tuckwila, WA 98188 Floor & Decor Parking and Trip Generation Study Page 2 May 2023 Figures 1 through 8 provide aerial location exhibits for each of the eight studied Floor & Decor stores. At each of the eight stores, Kimley-Horn staff collected weekday parking and trip generation data between Tuesday, November 29, 2022 and Tuesday, December 13, 2022. The weekday parking and trip generation data was collected from 7:00 AM to 9:30 AM and from 4:00 PM to 7:00 PM. Also, parking data collection was collected at the eight stores on either Saturday, December 3, 2022 or Saturday, December 10, 2022 from 11:00 AM to 2:00 PM. According to Floor & Decor, the stores do not typically experience seasonal variations in patrona ge levels and sales. Therefore, the data collection is anticipated to represent typical store conditions. In order to conduct the trip generation data collection, a Kimley -Horn staff member stood near the entrance to the Floor & Decor store and observed th e parking lot. When a vehicle entered the parking lot and a person or a group of people got out of a vehicle and entered the Floor & Decor store or customer pickup area, this was counted as one inbound vehicle trip. When a person or group of people exiting the Floor & Decor store or customer pickup area got into a vehicle and exited the parking lot, this was counted as one outbound vehicle trip. This trip generation data collection method was used recognizing that several of the studied Floor & Decor stores are within shopping centers having multiple tenants, and this was the most efficient way to isolate trips specifically destined to/from the studied Floor & Decor store s. It should be noted that truck delivery trips to/from the rears/sides of the stores were not quantified as these trips are minimal, especially during peak hours. Also, there are customer pickup areas at the rear of two of the stores (North Charleston and Cypress) that are not visible from the main entrance. Trips to/from these two customer pickup areas were not quantified as they are thought to be minimal. Trips to/from the other six customer pickup areas are visible from the main entrance and were included in the trip counts. Appendix A contains samples of the data collection worksheets used at the eight stores in which data was collected. The parking data collected at each of the eight stores is included in Appendix B, and the trip generation data is included in Appendix C. N MAIN ENTRANCE DORAL, FL 33122 2525 NW 82ND AVE, DORAL STORE: AND TRIP GENERATION STUDY FLOOR & DECOR PARKING FIGURE 1NW 82ND AVENW 25TH ST NALEXANDRIA, VA 22304 4607 EISENHOWER AVE ALEXANDRIA STORE: AND TRIP GENERATION STUDY FLOOR & DECOR PARKING FIGURE 2 MAIN ENTRANCE EI SENHOWER AVECLERMONT AVE NMAIN ENTRANCE POMPANO BEACH, FL 33069 1914 W ATLANTIC BLVD POMPANO BEACH STORE: AND TRIP GENERATION STUDY FLOOR & DECOR PARKING FIGURE 3W ATLANTIC BLVDMAGNER DR N MAIN ENTRANCE FARMINGDALE, NY 11735 1002 BROAD HOLLOW RD FARMINGDALE STORE: AND TRIP GENERATION STUDY FLOOR & DECOR PARKING FIGURE 4BROADHOLLOW RDM ICHAEL AVE N MAIN ENTRANCE CHARLESTON, SC 29406 6029 RIVERS AVE NORTH CHARLESTON STORE: AND TRIP GENERATION STUDY FLOOR & DECOR PARKING FIGURE 5 AVIATION AVE I- 2 6 RI VE RS AVE N AVON, MA 02322 80 STOCKWELL DR AVON STORE: AND TRIP GENERATION STUDY FLOOR & DECOR PARKING FIGURE 6 MAIN ENTRANCE FALL RIVER EXPYSTOCKWELL DRHARRISON BLVD NHOUSTON, TX 77065 20502 HEMPSTEAD RD CYPRESS STORE: AND TRIP GENERATION STUDY FLOOR & DECOR PARKING FIGURE 7 MAIN ENTRANCE HUFFMEISTER RD HE MP S TE AD RDNORTHWEST FWY N MAIN ENTRANCE TUCKWILA, WA 98188 17651 SOUTHCENTER PKWY TUCKWILA STORE: AND TRIP GENERATION STUDY FLOOR & DECOR PARKING FIGURE 8SOUTHCENTER PKWYS 180TH ST Floor & Decor Parking and Trip Generation Study Page 11 May 2023 Results of Parking Data Collection Table 1 presents the results of the parking data collection. As shown in Table 1, the maximum parking rate in spaces per 1,000 square f eet of gross leasable area occurred during the Saturday data collection for all but two stores. The Saturday peak parking rates varied from 0.40 spaces per 1,000 square feet in North Charleston, South Carolina , (the lowest Saturday rate) to 0.90 spaces per 1,000 square feet in Doral, Florida (the highest Saturday rate). The average weekday AM peak parking rate for the eight stores was 0.45 spaces per 1,000 square feet. The average weekday PM peak parking rate was 0.43 spaces per 1,000 square feet. The average Saturday peak parking rate was 0.59 spaces per 1,000 square feet. Results of Trip Generation Data Collection Table 2 presents the results of the trip generation data collection. As shown in Table 2, the Tuckwila, Washington store experienced the lowest AM peak hour trip generation rate, and the Avon, Massachusetts store experienced the lowest PM peak hour trip generation rate. The Cypress, Texas store experienced the highest AM peak hour trip generation rate, and the Alexandria, Virginia store experienced the highest PM peak hour trip generation rate . The average AM peak hour trip generation rate for the eight stores was 0.76 trips per 1,000 square feet (53 percent inbound, 47 percent outbound). The average PM peak ho ur trip generation rate was 0.66 trips per 1,000 square feet (46 percent inbound, 54 percent outbound). Floor & Decor Parking and Trip Generation Study Page 12 May 2023 Table 1: Peak Parking Counts and Rates Date in 2022 Time Period Peak Time Maximum Number of Occupied Spaces Counted Parking Rate (spaces per 1,000 SF GLA) Thur, Dec 1 Weekday AM 9:30 AM 42 0.47 Wed, Nov 30 Weekday PM 4:00 PM 47 0.53 89,240 GLA Sat, Dec 3 Saturday Midday 1:30 PM 80 0.90 Tues, Nov 29 Weekday AM 9:30 AM 56 0.60 Tues, Nov 29 Weekday PM 4:15 PM 49 0.52 93,398 GLA Sat, Dec 3 Saturday Midday 1:00 PM 76 0.81 Wed, Nov 30 Weekday AM 9:00 AM 40 0.46 Wed, Nov 30 Weekday PM 4:00 PM 37 0.43 86,610 GLA Sat, Dec 3 Saturday Midday 12:15 PM 49 0.57 Wed, Nov 30 Weekday AM 9:00 AM, 9:15 AM 34 0.43 Wed, Nov 30 Weekday PM 5:00 PM 30 0.38 80,000 GLA Sat, Dec 3 Saturday Midday 12:45 PM 50 0.63 Tues, Dec 6 Weekday AM 9:15 AM 37 0.49 Tues, Dec 6 Weekday PM 4:00 PM 31 0.41 75,000 GLA Sat, Dec 3 Saturday Midday 2:00 PM 30 0.40 Tues, Dec 6 Weekday AM 8:45 AM 39 0.46 Tues, Dec 6 Weekday PM 4:30 PM 40 0.47 84,887 GLA Sat, Dec 10 Saturday Midday 11:00 AM, 11:15 AM 38 0.45 Wed, Dec 7 Weekday AM 8:45 AM, 9:30 AM 31 0.41 Wed, Dec 7 Weekday PM 4:00 PM 27 0.36 74,880 GLA Sat, Dec 10 Saturday Midday 1:30 PM 39 0.52 Thur, Dec 8 Weekday AM 9:30 AM 28 0.31 Tues, Dec 13 Weekday PM 5:15 PM, 5:30 PM 32 0.35 90,359 GLA Sat, Dec 10 Saturday Midday 1:45 PM, 2:00 PM 39 0.43 Average weekday AM peak parking rate of all eight stores:0.45 Average weekday PM peak parking rate of all eight stores:0.43 Average Saturday midday peak parking rate of all eight stores:0.59 Tuckwila, WA Store Location and Size Doral, FL Alexandria, VA Cypress, TX North Charleston, SC Pompano Beach, FL Farmingdale, NY Avon, MA Floor & Decor Parking and Trip Generation Study Page 13 May 2023 Table 2: Peak Hour Trip Generation Summary Date in 2022 Time Period Peak Hour Inbound Trips Outbound Trips Total Trips Trip Generation Rate (Trips per 1,000 SF GLA) Inbound Trip Percentage Outbound Trip Percentage Thur, Dec 1 Weekday AM 7:45 AM to 8:45 AM 32 27 59 0.66 54%46% 89,240 GLA Wed, Nov 30 Weekday PM 4:00 PM to 5:00 PM 28 34 62 0.69 45%55% Tues, Nov 29 Weekday AM 8:30 AM to 9:30 AM 39 39 78 0.84 50%50% 93,398 GLA Tues, Nov 29 Weekday PM 4:00 PM to 5:00 PM 38 42 80 0.86 48%52% Wed, Nov 30 Weekday AM 8:00 AM to 9:00 AM 42 41 83 0.96 51%49% 86,610 GLA Wed, Nov 30 Weekday PM 4:15 PM to 5:15 PM 34 30 64 0.74 53%47% Wed, Nov 30 Weekday AM 8:30 AM to 9:30 AM 30 27 57 0.71 53%47% 80,000 GLA Wed, Nov 30 Weekday PM 5:30 PM to 6:30 PM 23 19 42 0.53 55%45% Tues, Dec 6 Weekday AM 8:30 AM to 9:30 AM 30 24 54 0.72 56%44% 75,000 GLA Tues, Dec 6 Weekday PM 4:00 PM to 5:00 PM 22 29 51 0.68 43%57% Tues, Dec 6 Weekday AM 8:30 AM to 9:30 AM 31 26 57 0.67 54%46% 84,887 GLA Tues, Dec 6 Weekday PM 4:00 PM to 5:00 PM 19 23 42 0.49 45%55% Wed, Dec 7 Weekday AM 8:30 AM to 9:30 AM 38 35 73 0.97 52%48% 74,880 GLA Wed, Dec 7 Weekday PM 4:00 PM to 5:00 PM 18 29 47 0.63 38%62% Thur, Dec 8 Weekday AM 8:30 AM to 9:30 AM 27 20 47 0.52 57%43% 90,359 GLA Tues, Dec 13 Weekday PM 5:00 PM to 6:00 PM 27 34 61 0.68 44%56% Average AM peak hour trip generation rate of all eight stores and inbound/outbound percentage 0.76 Average PM peak hour trip generation rate of all eight stores and inbound/outbound percentage 0.66 (53% in, 47% out) (46% in, 54% out) Doral, FL Store Location and Size Alexandria, VA Pompano Beach, FL Farmingdale, NY North Charleston, SC Cypress, TX Avon, MA Tuckwila, WA Floor & Decor Parking and Trip Generation Study Page 14 May 2023 Summary Table 3 presents the average weekday AM and PM peak parking and trip generation rates as well as the average Saturday peak parking rate for the eight stores. Table 4 presents the highest weekday AM and PM parking and trip generation rates observed as well as the highest Saturday parking rate observed for the eight stores. Table 3: Average Parking and Trip Generation Rates Table 4: Highest Parking and Trip Generation Rates Time Period Average Peak Parking Rate (Occupied Spaces per 1,000 SF GLA) Average Peak Hour Trip Generation Rate (Trips Per Hour Per 1,000 SF GLA) Average Peak Hour Inbound Trip Percentage Average Peak Hour Outbound Trip Percentage AM Peak 0.45 0.76 53%47% PM Peak 0.43 0.66 46%54% Saturday Peak 0.59 - AM Peak 0.60 Alexandria 0.97 Cypress 52%48% PM Peak 0.53 Doral 0.86 Alexandria 50%50% Saturday Peak 0.90 Doral Time Period Inbound Trip Percentage at Store with Highest Trip Generation Outbound Trip Percentage at Store with Highest Trip Generation - Location of Store with Highest Parking Rate Location of Store with Highest Trip Generation Rate Highest Parking Rate (Occupied Spaces per 1,000 SF GLA) Highest Trip Generation Rate (Trips Per Hour Per 1,000 SF GLA) Floor & Decor Parking and Trip Generation Study Page 15 May 2023 Trip and Parking Rate Comparisons As mentioned previously, in order to determine the trip generation and required parking for a proposed Floor & Decor store, municipalities have historically used parking and trip generation rates that are based on studies for more traditional commercial retail stores. Table 5 shows the average weekday AM and PM peak hour trip generation rates for similar land uses based on data published by the Institute of Transportation Engineers (ITE) in Trip Generation, 11th Edition. As shown in Table 5, the average weekday peak hour trip generation rates calculated for Floor & Decor in this study are significantly lower than the average weekday peak hour trip generation rates published by ITE for a Shopping Plaza or a Home Improvement Superstore. Table 5: Trip Generation Rate Comparison Floor & Decor (From This Study) Shopping Plaza (40-150k) (ITE Land Use 821) Home Improvement Superstore (ITE Land Use 862) Weekday AM Peak 0.76 1.73 1.51 Weekday PM Peak 0.66 5.19 2.29 Average Peak Hour Trip Generation Rate (Trips Per Hour Per 1,000 SF GLA) Time Period Floor & Decor Parking and Trip Generation Study Page 16 May 2023 Table 6 shows the weekday and Saturday peak parking rates for similar land uses based on data published by ITE in Parking Generation, 5th Edition. As shown in Table 6, the average parking rates calculated for Floor & Decor in this study are significantly lower than the average parking rates published by ITE for a Shopping Center or a Home Improvement Superstore. Note that the Shopping Plaza (40-150k) category (Land Use 821) was shown in Table 5, as that category of shopping is consistent with the size of Floor & Decor stores. The Shopping Center (Land Use 820) category was shown in Table 6 because ITE does not separate the Shopping Center use into specific square footage categories in the Parking Generation Manual as they do in the Trip Generation Manual. Table 6: Parking Rate Comparison Floor & Decor (From This Study) Shopping Center (ITE Land Use 820) Home Improvement Superstore (ITE Land Use 862) Weekday 0.45 1.95 2.42* Saturday 0.59 2.91 3.36 *Friday Parking Rate Shown (Only Weekday Listed in ITE) Time Period Average Peak Parking Rate (Parked Vehicles Per 1,000 SF GLA) Floor & Decor Parking and Trip Generation Study Appendix A: Sample Parking and Trip Generation Data Collection Sheets N ALEXANDRIA, VA 22304 4607 EISENHOWER AVEFLOOR & DECOR COLLECTION PARKING DATA FLOOR & DECOR__ /10__ /9 __ /6 __ /10 __ /10 __ /7__ /11__ /6__ /9__ /10__ /9__ /4 __ /16 __ /17__ /9__ /6 DATE: TIME PERIOD: DATA COLLECTOR: EISENHOWER AVE 11/29/22 4:00 -4:15pmAdamO'Neill 0 0 I 5 6 , I 6 ✗9 0 ¥ 0 to 7 ?} DATE: 11-/ (o / 202.2. I I TIME PERIOD : <g ·. Lf 5 -q : 00 DAT A coLLEcToR: X ru1 ·, e v 12., ++'2..v FLOOR & DECOR °ct, 0 OR& DECOR c:i O O 0 rl C CJ 0 a r:::1 □ CJ 0 80 STOCKWELL DR AVON, MA 02322 PARKING DATA COLLECT/ON Location ___________________________________________ Date _______________________________________________ Analyst ___________________________________________ From To 7:00 AM 7:15 AM 7:15 AM 7:30 AM 7:30 AM 7:45 AM 7:45 AM 8:00 AM 8:00 AM 8:15 AM 8:15 AM 8:30 AM 8:30 AM 8:45 AM 8:45 AM 9:00 AM 9:00 AM 9:15 AM 9:15 AM 9:30 AM Time Inbound Vehicle Trips Outbound Vehicle Trips Floor & Decor Parking and Trip Generation Study Appendix B: Parking Data Collection Location: Doral, FL Time Total Parked Vehicles Time Total Parked Vehicles 7:00 AM 17 4:00 PM 47 7:15 AM 19 4:15 PM 40 7:30 AM 21 4:30 PM 37 7:45 AM 20 4:45 PM 42 8:00 AM 28 5:00 PM 39 8:15 AM 24 5:15 PM 30 8:30 AM 30 5:30 PM 26 8:45 AM 30 5:45 PM 23 9:00 AM 35 6:00 PM 19 9:15 AM 37 6:15 PM 25 9:30 AM 42 6:30 PM 26 6:45 PM 26 7:00 PM 19 Time Total Parked Vehicles 11:00 AM 54 11:15 AM 59 11:30 AM 61 11:45 AM 68 12:00 PM 60 12:15 PM 60 12:30 PM 66 12:45 PM 71 1:00 PM 73 1:15 PM 77 1:30 PM 80 1:45 PM 73 Saturday, December 3, 2022 Weekday PM Parking Data Wednesday, November 30, 2022 Weekday AM Parking Data Thursday, December 1, 2022 Saturday Midday Parking Data Location: Alexandria, VA Time Total Parked Vehicles Time Total Parked Vehicles 7:00 AM 26 4:00 PM 47 7:15 AM 32 4:15 PM 49 7:30 AM 29 4:30 PM 45 7:45 AM 37 4:45 PM 45 8:00 AM 31 5:00 PM 42 8:15 AM 37 5:15 PM 35 8:30 AM 43 5:30 PM 33 8:45 AM 39 5:45 PM 38 9:00 AM 47 6:00 PM 33 9:15 AM 53 6:15 PM 27 9:30 AM 56 6:30 PM 29 6:45 PM 21 7:00 PM 17 Time Total Parked Vehicles 11:00 AM 59 11:15 AM 62 11:30 AM 57 11:45 AM 63 12:00 PM 55 12:15 PM 62 12:30 PM 68 12:45 PM 66 1:00 PM 76 1:15 PM 69 1:30 PM 69 1:45 PM 64 2:00 PM 62 Saturday, December 3, 2022 Weekday AM Parking Data Weekday PM Parking Data Tuesday, November 29, 2022 Tuesday, November 29, 2022 Saturday Midday Parking Data Location: Pompano Beach, FL Time Total Parked Vehicles Time Total Parked Vehicles 7:00 AM 12 4:00 PM 37 7:15 AM 10 4:15 PM 34 7:30 AM 11 4:30 PM 35 7:45 AM 24 4:45 PM 36 8:00 AM 29 5:00 PM 31 8:15 AM 31 5:15 PM 28 8:30 AM 31 5:30 PM 23 8:45 AM 36 5:45 PM 24 9:00 AM 40 6:00 PM 24 9:15 AM 39 6:15 PM 28 6:30 PM 24 6:45 PM 17 7:00 PM 14 Time Total Parked Vehicles 11:00 AM 39 11:15 AM 41 11:30 AM 47 11:45 AM 48 12:00 PM 48 12:15 PM 49 12:30 PM 45 12:45 PM 45 1:00 PM 45 1:15 PM 44 1:30 PM 42 1:45 PM 36 2:00 PM 43 Saturday, December 3, 2022 Weekday AM Parking Data Weekday PM Parking Data Wednesday, November 30, 2022 Wednesday, November 30, 2022 Saturday Midday Parking Data Location: Farmingdale, NY Time Total Parked Vehicles Time Total Parked Vehicles 7:00 AM 20 4:30 PM 24 7:15 AM 21 4:45 PM 25 7:30 AM 22 5:00 PM 30 7:45 AM 22 5:15 PM 20 8:00 AM 25 5:30 PM 21 8:15 AM 27 5:45 PM 18 8:30 AM 30 6:00 PM 21 8:45 AM 30 6:15 PM 23 9:00 AM 34 6:30 PM 18 9:15 AM 34 6:45 PM 14 Time Total Parked Vehicles 11:00 AM 43 11:15 AM 42 11:30 AM 44 11:45 AM 44 12:00 PM 44 12:15 PM 45 12:30 PM 43 12:45 PM 50 1:00 PM 46 1:15 PM 40 1:30 PM 46 1:45 PM 44 Saturday, December 3, 2022 Weekday AM Parking Data Weekday PM Parking Data Tuesday, November 29, 2022 Wednesday, November 30, 2022 Saturday Midday Parking Data Location: North Charleston, SC Time Total Parked Vehicles Time Total Parked Vehicles 7:00 AM 13 4:00 PM 31 7:15 AM 19 4:15 PM 25 7:30 AM 17 4:30 PM 22 7:45 AM 19 4:45 PM 19 8:00 AM 22 5:00 PM 21 8:15 AM 22 5:15 PM 21 8:30 AM 26 5:30 PM 17 8:45 AM 26 5:45 PM 13 9:00 AM 28 6:00 PM 10 9:15 AM 37 6:15 PM 13 9:30 AM 35 6:30 PM 13 6:45 PM 15 7:00 PM 12 Time Total Parked Vehicles 11:00 AM 27 11:15 AM 26 11:30 AM 24 11:45 AM 23 12:00 PM 25 12:15 PM 23 12:30 PM 24 12:45 PM 22 1:00 PM 25 1:15 PM 25 1:30 PM 23 1:45 PM 29 2:00 PM 30 Saturday, December 3, 2022 Weekday AM Parking Data Weekday PM Parking Data Tuesday, December 6, 2022 Tuesday, December 6, 2022 Saturday Midday Parking Data Location: Avon, MA Time Total Parked Vehicles Time Total Parked Vehicles 7:00 AM 22 4:00 PM 34 7:15 AM 25 4:15 PM 35 7:30 AM 28 4:30 PM 40 7:45 AM 27 4:45 PM 31 8:00 AM 29 5:00 PM 28 8:15 AM 30 5:15 PM 29 8:30 AM 38 5:30 PM 27 8:45 AM 39 5:45 PM 29 9:00 AM 38 6:00 PM 29 9:15 AM 36 6:15 PM 30 6:30 PM 26 6:45 PM 29 Time Total Parked Vehicles 11:00 AM 38 11:15 AM 38 11:30 AM 35 11:45 AM 31 12:00 PM 28 12:15 PM 30 12:30 PM 30 12:45 PM 35 1:00 PM 34 1:15 PM 37 1:30 PM 36 1:45 PM 34 Saturday, December 10, 2022 Weekday AM Parking Data Weekday PM Parking Data Tuesday, December 6, 2022 Tuesday, December 6, 2022 Saturday Midday Parking Data Location: Cypress, TX Time Total Parked Vehicles Time Total Parked Vehicles 7:00 AM 18 4:00 PM 27 7:15 AM 18 4:15 PM 19 7:30 AM 16 4:30 PM 17 7:45 AM 20 4:45 PM 15 8:00 AM 23 5:00 PM 17 8:15 AM 24 5:15 PM 17 8:30 AM 26 5:30 PM 15 8:45 AM 31 5:45 PM 16 9:00 AM 25 6:00 PM 13 9:15 AM 30 6:15 PM 17 9:30 AM 31 6:30 PM 18 6:45 PM 17 7:00 PM 12 Time Total Parked Vehicles 11:00 AM 26 11:15 AM 25 11:30 AM 25 11:45 AM 29 12:00 PM 25 12:15 PM 27 12:30 PM 26 12:45 PM 27 1:00 PM 31 1:15 PM 37 1:30 PM 39 1:45 PM 32 2:00 PM 28 Saturday, December 10, 2022 Weekday AM Parking Data Weekday PM Parking Data Wednesday, December 7, 2022 Wednesday, December 7, 2022 Saturday Midday Parking Data Location: Tuckwila, WA Time Total Parked Vehicles Time Total Parked Vehicles 7:00 AM 7 4:00 PM 22 7:15 AM 12 4:15 PM 23 7:30 AM 14 4:30 PM 25 7:45 AM 16 4:45 PM 25 8:00 AM 16 5:00 PM 27 8:15 AM 22 5:15 PM 32 8:30 AM 18 5:30 PM 32 8:45 AM 20 5:45 PM 26 9:00 AM 18 6:00 PM 26 9:15 AM 22 6:15 PM 19 9:30 AM 28 6:30 PM 18 6:45 PM 19 7:00 PM 13 Time Total Parked Vehicles 11:00 AM 37 11:15 AM 36 11:30 AM 31 11:45 AM 29 12:00 PM 30 12:15 PM 28 12:30 PM 32 12:45 PM 29 1:00 PM 30 1:15 PM 33 1:30 PM 35 1:45 PM 39 2:00 PM 39 Saturday, December 10, 2022 Weekday AM Parking Data Weekday PM Parking Data Thursday, December 8, 2022 Tuesday, December 13, 2022 Saturday Midday Parking Data Floor & Decor Parking and Trip Generation Study Appendix C: Trip Generation Data Collection Location: Doral, FL From To Inbound Trips Outbound Trips Total Trips 7:00 AM 7:15 AM 2 1 3 7:15 AM 7:30 AM 6 1 7 7:30 AM 7:45 AM 3 6 9 7:45 AM 8:00 AM 9 4 13 8:00 AM 8:15 AM 10 5 15 8:15 AM 8:30 AM 7 12 19 8:30 AM 8:45 AM 6 6 12 8:45 AM 9:00 AM 5 3 8 9:00 AM 9:15 AM 9 11 20 9:15 AM 9:30 AM 11 4 15 From To Inbound Trips Outbound Trips Total Trips 4:00 PM 4:15 PM 8 8 16 4:15 PM 4:30 PM 4 8 12 4:30 PM 4:45 PM 8 4 12 4:45 PM 5:00 PM 8 14 22 5:00 PM 5:15 PM 5 10 15 5:15 PM 5:30 PM 5 6 11 5:30 PM 5:45 PM 5 7 12 5:45 PM 6:00 PM 5 3 8 6:00 PM 6:15 PM 6 4 10 6:15 PM 6:30 PM 3 3 6 6:30 PM 6:45 PM 5 5 10 6:45 PM 7:00 PM 5 8 13 Total 59 Trips Total 62 Trips Weekday AM Trip Generation Thursday, December 1, 2022 Weekday PM Trip Generation Wednesday, November 30, 2022 Location: Alexandria, VA From To Inbound Trips Outbound Trips Total Trips 7:00 AM 7:15 AM 10 6 16 7:15 AM 7:30 AM 5 7 12 7:30 AM 7:45 AM 11 9 20 7:45 AM 8:00 AM 7 9 16 8:00 AM 8:15 AM 10 7 17 8:15 AM 8:30 AM 7 6 13 8:30 AM 8:45 AM 5 10 15 8:45 AM 9:00 AM 11 9 20 9:00 AM 9:15 AM 12 9 21 9:15 AM 9:30 AM 11 11 22 From To Inbound Trips Outbound Trips Total Trips 4:00 PM 4:15 PM 10 12 22 4:15 PM 4:30 PM 13 13 26 4:30 PM 4:45 PM 6 8 14 4:45 PM 5:00 PM 9 9 18 5:00 PM 5:15 PM 8 13 21 5:15 PM 5:30 PM 5 7 12 5:30 PM 5:45 PM 6 5 11 5:45 PM 6:00 PM 13 9 22 6:00 PM 6:15 PM 6 9 15 6:15 PM 6:30 PM 12 13 25 6:30 PM 6:45 PM 5 9 14 6:45 PM 7:00 PM 1 5 6 Weekday AM Trip Generation Tuesday, November 29, 2022 Weekday PM Trip Generation Tuesday, November 29, 2022 Total 80 Trips Total 78 Trips Location: Pompano Beach, FL From To Inbound Trips Outbound Trips Total Trips 7:00 AM 7:15 AM 3 1 4 7:15 AM 7:30 AM 1 1 2 7:30 AM 7:45 AM 2 2 4 7:45 AM 8:00 AM 8 1 9 8:00 AM 8:15 AM 12 9 21 8:15 AM 8:30 AM 8 7 15 8:30 AM 8:45 AM 9 10 19 8:45 AM 9:00 AM 13 15 28 9:00 AM 9:15 AM 11 5 16 9:15 AM 9:30 AM 8 9 17 From To Inbound Trips Outbound Trips Total Trips 4:00 PM 4:15 PM 3 6 9 4:15 PM 4:30 PM 11 7 18 4:30 PM 4:45 PM 12 9 21 4:45 PM 5:00 PM 5 8 13 5:00 PM 5:15 PM 6 6 12 5:15 PM 5:30 PM 4 3 7 5:30 PM 5:45 PM 3 3 6 5:45 PM 6:00 PM 6 6 12 6:00 PM 6:15 PM 7 1 8 6:15 PM 6:30 PM 7 6 13 6:30 PM 6:45 PM 1 6 7 6:45 PM 7:00 PM 3 5 8 Total 64 Trips Weekday AM Trip Generation Wednesday, November 30, 2022 Weekday PM Trip Generation Wednesday, November 30, 2022 Total 83 Trips Location: Farmingdale, NY From To Inbound Trips Outbound Trips Total Trips 7:00 AM 7:15 AM 3 0 3 7:15 AM 7:30 AM 0 3 3 7:30 AM 7:45 AM 5 1 6 7:45 AM 8:00 AM 8 3 11 8:00 AM 8:15 AM 4 8 12 8:15 AM 8:30 AM 6 6 12 8:30 AM 8:45 AM 7 3 10 8:45 AM 9:00 AM 10 8 18 9:00 AM 9:15 AM 5 7 12 9:15 AM 9:30 AM 8 9 17 From To Inbound Trips Outbound Trips Total Trips 4:30 PM 4:45 PM 2 3 5 4:45 PM 5:00 PM 2 2 4 5:00 PM 5:15 PM 4 4 8 5:15 PM 5:30 PM 4 3 7 5:30 PM 5:45 PM 7 5 12 5:45 PM 6:00 PM 4 4 8 6:00 PM 6:15 PM 6 2 8 6:15 PM 6:30 PM 6 8 14 6:30 PM 6:45 PM 4 7 11 6:45 PM 7:00 PM 3 5 8 Total 42 Trips Weekday AM Trip Generation Wednesday, November 30, 2022 Weekday PM Trip Generation Wednesday, November 30, 2022 Total 57 Trips Location: North Charleston, SC From To Inbound Trips Outbound Trips Total Trips 7:00 AM 7:15 AM 10 2 12 7:15 AM 7:30 AM 4 5 9 7:30 AM 7:45 AM 5 4 9 7:45 AM 8:00 AM 4 4 8 8:00 AM 8:15 AM 5 5 10 8:15 AM 8:30 AM 4 2 6 8:30 AM 8:45 AM 9 6 15 8:45 AM 9:00 AM 5 4 9 9:00 AM 9:15 AM 8 5 13 9:15 AM 9:30 AM 8 9 17 From To Inbound Trips Outbound Trips Total Trips 4:00 PM 4:15 PM 8 10 18 4:15 PM 4:30 PM 5 5 10 4:30 PM 4:45 PM 4 9 13 4:45 PM 5:00 PM 5 5 10 5:00 PM 5:15 PM 6 6 12 5:15 PM 5:30 PM 4 3 7 5:30 PM 5:45 PM 5 6 11 5:45 PM 6:00 PM 6 7 13 6:00 PM 6:15 PM 3 1 4 6:15 PM 6:30 PM 5 1 6 6:30 PM 6:45 PM 1 2 3 6:45 PM 7:00 PM 1 6 7 Total 51 Trips Weekday AM Trip Generation Tuesday, December 6, 2022 Total 54 Trips Weekday PM Trip Generation Tuesday, December 6, 2022 Location: Avon, MA From To Inbound Trips Outbound Trips Total Trips 7:00 AM 7:15 AM 3 0 3 7:15 AM 7:30 AM 2 3 5 7:30 AM 7:45 AM 7 2 9 7:45 AM 8:00 AM 4 3 7 8:00 AM 8:15 AM 2 7 9 8:15 AM 8:30 AM 4 2 6 8:30 AM 8:45 AM 12 4 16 8:45 AM 9:00 AM 6 8 14 9:00 AM 9:15 AM 6 10 16 9:15 AM 9:30 AM 7 4 11 From To Inbound Trips Outbound Trips Total Trips 4:00 PM 4:15 PM 2 6 8 4:15 PM 4:30 PM 8 3 11 4:30 PM 4:45 PM 5 7 12 4:45 PM 5:00 PM 0 8 8 5:00 PM 5:15 PM 6 5 11 5:15 PM 5:30 PM 3 4 7 5:30 PM 5:45 PM 3 3 6 5:45 PM 6:00 PM 6 4 10 6:00 PM 6:15 PM 5 6 11 6:15 PM 6:30 PM 1 1 2 6:30 PM 6:45 PM 2 5 7 6:45 PM 7:00 PM 1 6 7 Total 42 Trips Weekday AM Trip Generation Tuesday, December 6, 2022 Total 57 Trips Weekday PM Trip Generation Tuesday, December 6, 2022 Location: Cypress, TX From To Inbound Trips Outbound Trips Total Trips 7:00 AM 7:15 AM 4 0 4 7:15 AM 7:30 AM 2 3 5 7:30 AM 7:45 AM 4 1 5 7:45 AM 8:00 AM 5 2 7 8:00 AM 8:15 AM 4 6 10 8:15 AM 8:30 AM 6 3 9 8:30 AM 8:45 AM 6 4 10 8:45 AM 9:00 AM 13 14 27 9:00 AM 9:15 AM 12 5 17 9:15 AM 9:30 AM 7 12 19 From To Inbound Trips Outbound Trips Total Trips 4:00 PM 4:15 PM 5 17 22 4:15 PM 4:30 PM 6 7 13 4:30 PM 4:45 PM 2 4 6 4:45 PM 5:00 PM 5 1 6 5:00 PM 5:15 PM 3 5 8 5:15 PM 5:30 PM 6 6 12 5:30 PM 5:45 PM 4 3 7 5:45 PM 6:00 PM 4 6 10 6:00 PM 6:15 PM 5 2 7 6:15 PM 6:30 PM 2 4 6 6:30 PM 6:45 PM 3 4 7 6:45 PM 7:00 PM 1 7 8 Total 47 Trips Weekday AM Trip Generation Wednesday, December 7, 2022 Total 73 Trips Weekday PM Trip Generation Wednesday, December 7, 2022 Location: Tuckwila, WA From To Inbound Trips Outbound Trips Total Trips 7:00 AM 7:15 AM 3 1 4 7:15 AM 7:30 AM 6 3 9 7:30 AM 7:45 AM 4 2 6 7:45 AM 8:00 AM 3 2 5 8:00 AM 8:15 AM 9 6 15 8:15 AM 8:30 AM 6 6 12 8:30 AM 8:45 AM 5 6 11 8:45 AM 9:00 AM 3 3 6 9:00 AM 9:15 AM 5 5 10 9:15 AM 9:30 AM 14 6 20 From To Inbound Trips Outbound Trips Total Trips 4:00 PM 4:15 PM 7 7 14 4:15 PM 4:30 PM 3 3 6 4:30 PM 4:45 PM 11 5 16 4:45 PM 5:00 PM 7 3 10 5:00 PM 5:15 PM 5 4 9 5:15 PM 5:30 PM 6 10 16 5:30 PM 5:45 PM 10 12 22 5:45 PM 6:00 PM 6 8 14 6:00 PM 6:15 PM 2 6 8 6:15 PM 6:30 PM 3 8 11 6:30 PM 6:45 PM 6 6 12 6:45 PM 7:00 PM 3 6 9 Total 61 Trips Weekday AM Trip Generation Thursday, December 8, 2022 Total 47 Trips Weekday PM Trip Generation Tuesday, December 13, 2022 Southlake Corridor Planning Committee Meeting Report Meeting 42 – March 29, 2023 MEETING LOCATION: 1400 Main St., Southlake, Texas 76092 City Council Chambers IN ATTENDANCE: • City Council Members: Shawn McCaskill, Amy Torres-Lepp, Kathy Talley, • Planning & Zoning Commission Members: Austin Reynolds, Michael Springer • Park Board Member: Frances Scharli • City Staff: Dennis Killough, Jenny Crosby, Madeline Prater AGENDA ITEMS: 1. Call to Order. 2. Administrative Comments. 3. Review, discuss and make recommendations on the proposed Floor and Decor located on approximately 8 acres located at 2185 E. Southlake Blvd., generally located south of E. Southlake Blvd., west of S. Kimball Ave. and north of S. Village Center Dr. 4. Review, discuss and make recommendations on proposed modification of permitted uses on Pinnacle Point Ph. II, located at 425 - 455 S. Kimball Avenue. 5. Review and make a recommendation for the proposed Moon Valley Nursery on approximately 11 acres located at 755 Randol Mill Avenue . 6. Review and make recommendations on proposed modification of permitted uses for the Wheelhouse development located at 880 – 950 Davis Boulevard. 7. Review, discuss and make recommendations for proposed revisions to the Feedstore BBQ site on approximately 2.15 acres located at 520 and 530 S. White Chapel Blvd. 8. Adjournment. MEETING OVERVIEW: On March 29, 2023 the Southlake Corridor Planning Committee held their forty-second meeting. The Committee was sent a packet of materials prior to the meeting that were to be discussed during the session. A meeting agenda was posted, and the meeting time was advertised on the City’s website. The following meeting report focuses on discussion points made during the meeting by members of the Committee, public and City staff. This report is neither verbatim nor does it represent official meeting minutes; rather it serves to inform elected and appointed officials, City staff, and the public of the issues and questions raised by the Committee, City staff, and any attendees of the meeting. Interested parties are strongly encouraged to follow development cases through the process. Please visit CityofSouthlake.com/Planning for more information. Southlake Corridor Planning Committee Item #3 – Floor & Decor Meeting #42 – March 29, 2023 Page 3 ITEM #3 DISCUSSION – Review, discuss and make recommendations on the proposed Floor and Decor located on approximately 8 acres located at 2185 E. Southlake Blvd., generally located south of E. Southlake Blvd., west of S. Kimball Ave. and north of S. Village Center Dr. Staff presentation: Jenny Crosby • Future Land Use – Office Commercial and Retail Commercial o Applicant needs a land use plan amendment. • Zoning – B1 Business Service Park • Proposed Site Plan – 75,000 sq. ft. retail building for Floor & Décor • Village Center connection to S. Kimball Ave. Questions for staff by the Committee: N/A Applicant Presentation: Vanessa Masell Questions for Applicant by the Committee: Kathy Talley: This is essentially a pick-up store and not go shop in store? Applicant: It's both. Kathy Talley: Do more people pick up or shop in? Applicant: Its evenly split. Kathy Talley: I’m assuming semi-trucks will make the deliveries? Applicant: Correct. Kathy Talley: Is the road behind the proposed store sufficient for that type of delivery? Dennis Killough: Yes, it is a collector road. Shawn McCaskill: Multiple proposals and ideas for this piece of property. This is probably the best fit for that location. Work with city staff on building design, articulation, and materials. I like the concept. Amy Torres-Lepp: For some reason this is striking me as too big of a building for the space, especially off Southlake Blvd. with semi-truck deliveries and traffic. I will want to see a smaller footprint. Kathy Talley: I have the same sentiment, but reducing parking might help. Talk with staff about a tree variance. Southlake Corridor Planning Committee Item #3 – Floor & Decor Meeting #42 – March 29, 2023 Page 4 Michael Springer: I have concerns with Southlake Blvd. access because that is a busy intersection there. Especially around lunchtime with all the restaurants back in there. It’s one way in and one way out, so you need to make sure you have adequate access in other areas. Do you have plans to interconnect with the school next door? Applicant: Yes, staff recommended a street connection from the east to west of our property. Austin Reynolds: You mentioned that the average building size is 80,000 sq. ft., so is the 75,000 sq. ft. close to the 80,000? Applicant: This is typically a smaller building footprint for us, but 75,000 sq. ft. will still service our needs. Austin Reynolds: Do you have smaller prototypes? Applicant: We do that are more served for smaller markets that do not have a high build forecast. The size of this building is based off our forecast for this area, which is why we want to stay within the 75,000 sq. ft. range. Amy Torres-Lepp: Dennis, how big is the store next door to PGA Superstore? Applicant: I did some research today and it might be over 100,000 sq. ft. of floor space . Austin Reynolds: Are you saying Marshalls and PGA Superstore together? Applicant: Yes, with those two combined the footprint is over 100,000 sq. ft. Dennis Killough: That might be close to correct. Amy Torres-Lepp: Regarding the warehouse, as you go through the process we will want details on hours for semi-trucks, especially during lunch time. Be prepared with those answers and studies. Applicant: Typically do overnight deliveries to keep trucks off busy roads during peak hours. That is something we would look to propose. Frances Scharli: The adjacent school creates a lot of traffic in the morning and around 3:00 PM. I would be sensitive to signage, especially in Southlake. The proposed signage might not work. Southlake Corridor Planning Committee Item #3 – Floor & Decor Meeting #42 – March 29, 2023 Page 5 STAFF PRESENTATION SHOWN TO COMMITTEE: Southlake Corridor Planning Committee Item #3 – Floor & Decor Meeting #42 – March 29, 2023 Page 6 Southlake Corridor Planning Committee Item #3 – Floor & Decor Meeting #42 – March 29, 2023 Page 7 Southlake Corridor Planning Committee Item #3 – Floor & Decor Meeting #42 – March 29, 2023 Page 8 Southlake Corridor Planning Committee Item #3 – Floor & Decor Meeting #42 – March 29, 2023 Page 9 Southlake Corridor Planning Committee Item #3 – Floor & Decor Meeting #42 – March 29, 2023 Page 10 Southlake Corridor Planning Committee Item #3 – Floor & Decor Meeting #42 – March 29, 2023 Page 11 Southlake Corridor Planning Committee Item #3 – Floor & Decor Meeting #42 – March 29, 2023 Page 12 SPIN MEETING REPORT SPIN Item Number: SPIN2023-08 City Case Number: ZA23-0042 Project Name: Floor & Decor SPIN Neighborhood: 8 Meeting Date: April 25, 2023 Meeting Location: 1400 Main Street, Southlake, TX City Council Chambers Total Attendance: 30 Hosts: Mark Flores Applicant Presenting: Vanessa Masell City Staff Present: Madeline Prater, Business Manager Town Hall Forums can be viewed in their entirety by visiting http://www.cityofsouthlake.com and clicking on “I Want to” and “View” “Video on Demand” – forums are listed under SPIN by meeting date. FORUM SUMMARY: Property Situation: 2185 E. Southlake Blvd. Development Details: • Conceptual Site Plan – 75,000 sq. ft. retail building on approx. 7.8 acres o 78% sales floor o 4% office o 18% warehouse • Adequate parking for F&D use • Tree preservation and new landscape plantings • Landscape buffer areas along southern and western property lines • Building footprint will align with Marshalls and PGA Superstore buildings • Building will face Southlake Blvd. • Customer pick-up area will be added to the front left of the building for contractors • Proposing a new driveway connection to the existing public street (S. Kimball Ave.) Presentation: Comments, Questions and Concerns: Question: Access towards rear of building for deliveries – you are proposing to extend the roadway near the school to S. Kimball Ave? Answer: Correct, the city will require us to extend the public roadway from the eastern property line to the western property line. Comment: The schematic shows only one reasonable way for deliveries to be made, which is using the street right next to the school. That is a highly utilized pickup area, so I would be concerned for the children’s safety. The city’s responsibility is to protect the safety of our children and the citizens. You will be adding semi-trucks, box trucks, contractor delivery trucks, and pick-up trucks with trailers/flatbeds all coming through by the school because you cannot use 1709 as an access point – there is not enough room. For these reasons, I oppose this plan. Answer: As a part of this plan, we will work with staff to obtain approvals for delivery after operating hours, which would keep large trucks off the public roadways during peak school traffic hours. We can also look to limit the delivery hours to certain times throughout the night. There is enough room for trucks to use the access point from 1709, they do not have to always use S. Kimball Ave. Comment: I agree, there is no room for trucks to use the access from 1709 to make deliveries. This is not a good place for this development. There are many other spots for this development in the city. Many of our kids go to that adjacent school. What are the noise ordinances for making deliveries at night? I know Central Market has a sign that indicates no semi-truck deliveries between 11:00 PM and 6:00 AM. Comment: I am also concerned as a parent. I already see semi-trucks come through our neighborhood because they are lost. I’ve witnessed 5-6 accidents all on S. Kimball Ave. from cars trying to make a blind left at the north exit of PGA Superstore. I’m worried that trucks will not know they are entering a school zone until they are upon it. This school does have peak drop-off and pick- up hours; however, it is also busy during evening hours for sporting events and on the weekends for extracurricular activities. This school is used well into the night for practices throughout the year. This is a very high use area, and we are concerned about the safety of our kids. We are a supportive community and there are many other locations where this development can go. When developments begin to creep into residential areas, you will start to see pushback from the residents. Comment/Question: I am a former councilmember and worked on the city’s master plan, and this area has always been difficult. We do welcome your business to our town; however, for this spot this is too high intense of a use. Are you planning to build up the land more when you put your foundation in? Answer: We do not know where the building will fit from a topography standpoint because we have not begun the engineering for the site. Comment: I encourage you to look into that, because when dirt moves, we get into the drainage of the area – a part goes north, and a part goes south. When you build up, the lighting also goes higher. Please look into other options for this development. Answer: Drainage and stormwater runoff is a huge piece of the development process, so they would not allow us to project approval without extensive plans. Comment: This building is not compatible with our neighborhood. I’m concerned about your truck traffic and our children’s safety. We will have light problems and serious drainage problems. I am opposed to the design and placement of the building next the school. Comment: I feel like this is a bad placement for this type of development. I’ve visited two other Floor & Décor locations that are off major highways. We also have a Lowe’s and Home Depot already that I would hate to see not thrive due to your store. Response: Lowe’s and Home Depot only have about 4 aisles of hard surface flooring. I don’t believe these businesses will be affected by a Floor & Décor coming in. Comment: My main concern is traffic. Comment: I do not see any routes for traffic flow/deliveries or articulation of the building on this plan, so we would like to see those. Response: We will have to continue the road off S. Kimball Ave., it’s a requirement from the city. So, we would assume a similar traffic pattern to what Marshall’s and PGA Superstore use now for that access off S. Kimball Ave. Comment: I’m a parent and I’m afraid of all the trucks and trailers using the road connection next to the school to access this property. There are many kids who walk to school using this area. You cannot compare the amount of traffic for Marshall’s and PGA Superstore to this type of development because of the offerings they have. The construction materials and types of trucks used to haul equipment away vs a golfer or a shopper does not compare. Response: Most of our contractors and merchandisers pick up their materials in pick-up trucks and sometimes trailers. Comment: Regardless, the type of traffic this development will bring is so unsafe. I will continue showing up to protest this. Comment: I am here to oppose this item tonight. What I can’t connect is we have industrial type areas in east Southlake, and I believe this development is more commercial and industrial then retail. Response: Retail makes up 80% of the building. All sales are retail. SPIN Meeting Reports are general observations of SPIN Meetings by City staff and SPIN Representatives. The report is neither verbatim nor official meeting minutes; rather it serves to inform elected and appointed officials, City staff, and the public of the issues and questions raised by residents and the general responses made. Responses as summarized in this report should not be taken as guarantees by the applicant. Interested parties are strongly encouraged to follow the case through the Planning and Zoning Commission and final action by City Council. Online Question and Comment Forms: Southlake Connect Results for the April 25, 2023 SPIN Town Hall Forum TRAFFIC IMPACT ANALYSIS Floor and Decor FM 1709 / Kimball Avenue Southlake, Texas July 26, 2023 , PE 07/26/2023 Signature of Registrant Date Halff Associates, Inc. – TBPELS Engineering Firm #312 Prepared for Floor and Decor 1201 North Bowser Road Richardson, Texas 75081 AVO 54063 TBPELS Engineering Firm Registration No. 312 Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - i - Executive Summary Halff conducted a Traffic Impact Analysis (TIA) on behalf Floor & Decor for a proposed Floor & Decor store to be located in the southwest quadrant of the FM 1709 (Southlake Boulevard) / Kimball Avenue intersection in Southlake, Texas. The development site, covering an area of approximately 8 acres, will contain a 75,000-square foot (sf) Floor & Decor store. Access to the development site will be provided by one existing driveway connection to FM 1709 and two existing connections to Kimball Avenue. Per information provided by the developer, construction of the proposed Floor & Decor store is anticipated to begin in January 2024, with the store scheduled to open in October or November 2024. The TIA was conducted for submittal to the City of Southlake to support the proposed development of the property. The TIA examined the projected traffic operations at five study intersections within the study area, including the three existing site access connections that will serve the development site. Halff evaluated the AM, school PM and commuter PM peak hour operations at the study intersections for the various analysis scenarios to identify the potential impacts that the development traffic could have on the surrounding roadway network. The TIA also addressed site access and circulation and activity around the loading dock of the adjacent retail building. The results of the peak hour intersection analyses indicate that the proposed Floor & Decor store is not projected to impact the peak hour operations of the study intersection. The addition of trips generated by the proposed development does not change the LOS from the No Build to the Build scenarios, with only one exception: • Kimball Ave at the Kimball Oaks driveway - Commuter PM peak hour – the eastbound left / through movement is projected to decrease from a LOS E to F from the 2024 No Build to the 2024 Build scenario o It should be noted that this movement currently operates at a LOS E, and is projected to operate at a LOS F in the 2029 (No Build + 5 Years) and 2029 (Build + 5 Years) scenarios All other movements at the study intersections are projected to maintain their LOS from the No Build to the Build scenarios. The development site will be accessible from three existing driveway connections to adjacent streets. The existing driveway connection to FM 1709 at the first median opening west of Kimball Avenue will provide access to the north – south drive aisle running along the east side of the building. The existing driveway connection to Kimball Avenue at the first median opening south of FM 1709 will provide access to the east – west drive aisle that connects to the aforementioned north – south drive aisle. Access will also be available from Village Center Drive via its connection with the north – south drive aisle at the southeast corner of the subject tract (southwest corner of the Marshalls / PGA Superstore building). The Floor & Decor building will be oriented to face FM 1709, with two driveway connections to the existing north – south drive aisle on the east side of the building. All three driveways providing access to the site from FM 1709 and Kimball Avenue have the following characteristics: • Left and right turn deceleration lanes along the major street • Two-lane approaches to the major street • Stop control at the major street Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - ii - These driveways currently provide access to the Kimball Oaks retail development which surrounds the north and east sides of the Floor & Decor site. The south connection, Village Center Drive, also provides access to the student drop off / pick up area for Dawson Middle School via the driveway intersection 350 feet west of Kimball Avenue, across from the driveway access the loading dock area of the Marshalls / PGA Superstore building. The proposed Floor & Decor building orientation has the loading dock on the south side of the building. The proposed truck route to / from the loading dock has trucks entering the Kimball Oaks development at the driveway connection to FM 1709, traveling south along the north – south drive aisle to the northern Floor & Decor driveway, turning right (west) into the north driveway, looping counterclockwise around the building, and backing into the dock on the south side of the building. Exiting the store, trucks will turn left (north) from the southern Floor & Decor driveway onto the north – south drive aisle, and travel north along the drive aisle to the driveway connection to FM 1709. Halff collected three (3) days of traffic counts at the access connections to the loading dock area on the south side of the Marshalls / PGA Superstore building, to identify current heavy vehicle activity in this area. A total of 108 heavy vehicle trips were observed across the three days that traffic count data was collected, an average of 36 heavy vehicle trips per day. Since each trip represents a one-way movement, either in to or out of the development, this equates to 18 heavy vehicles entering and exiting the Kimball Oaks site each day. Of the 108 total daily trips, 14 were observed entering the Dawson MS site from Village Center Drive. The count data also showed that heavy vehicle activity during the school AM and PM peak periods is minimal. An average of 2 heavy vehicle trips during the AM peak period and 5 heavy vehicle trips during the school PM peak period were observed across the three-day count duration. One of the AM peak period trips was associated with the school. It is important to note that the trips observed at the Kimball Avenue / Kimball Oaks driveway intersection cannot all be assumed to be associated with the Marshalls / PGA Superstore building, as there are seven other retail buildings within the Kimball Oaks that could be served by some of the truck traffic entering / exiting the site at this location. Based on the analyses conducted for the TIA and a review of the development plans, the table below provides recommendations to accommodate projected traffic, where necessary, related to the proposed Floor & Decor store in Southlake, Texas. Study Year Recommendation Responsible Party 2024 Work with store management to schedule heavy vehicle activity outside of school AM and PM peak periods Developer 2024 Maintain clear sight visibility around the site driveway approaches to the north – south drive aisle running along the east side of the development Developer 2024 Install stop signs and stop bars at the eastbound site driveway approaches to the north – south drive aisle running along the east side of the development. Developer 2024 Grant a variance for the location of the proposed south site driveway connection to the north – south drive aisle, with respect to its proximity to Village Center Drive City Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - iii - Table of Contents Executive Summary ....................................................................................................................................... i Table of Contents .......................................................................................................................................... iii List of Appendices ......................................................................................................................................... iii List of Tables ................................................................................................................................................. iv List of Figures ................................................................................................................................................ iv I. Introduction ...................................................................................................................................... 1 II. Purpose and Methodology ............................................................................................................... 2 III. Site Location / Study Area ............................................................................................................... 3 IV. Development, Zoning, and Site Access ........................................................................................... 3 A. Existing Zoning ...................................................................................................................... 3 B. Existing Development ............................................................................................................... 3 C. Proposed Zoning ....................................................................................................................... 3 D. Proposed Development ......................................................................................................... 3 E. Proposed Site Access Points (Driveways) ................................................................................ 4 V. Existing Roadway Conditions .......................................................................................................... 5 VI. Future Roadway Conditions ............................................................................................................. 5 VII. Existing Traffic Volumes................................................................................................................... 6 VIII. Projected Traffic Volumes ................................................................................................................ 6 A. No Build Volumes .................................................................................................................. 6 B. Build Volumes ........................................................................................................................... 6 IX. Trip Generation ................................................................................................................................ 7 A. Existing Site Trip Generation ................................................................................................ 7 B. Proposed Site Trip Generation .................................................................................................. 7 X. Trip Distribution ................................................................................................................................ 8 A. General Trip Distribution Percentages .................................................................................. 8 B. Detailed Trip Distribution Percentages...................................................................................... 8 XI. Trip Assignment ............................................................................................................................... 8 XII. Intersection LOS Analyses ............................................................................................................... 9 A. Methodology and Level of Service Evaluations .................................................................... 9 B. Summary of Intersection LOS Analyses Results .................................................................... 13 XIII. Site Access Evaluation................................................................................................................... 14 XIV. Loading Dock Evaluation ............................................................................................................... 14 XV. Recommendations ......................................................................................................................... 15 List of Appendices Appendix A – Site Plan – Floor & Decor Development ................................................................................. A Appendix B – Traffic Count Data .................................................................................................................. B Appendix C – Turning Movement Traffic Volume Exhibits ........................................................................... C Appendix D – Synchro Report Sheets .......................................................................................................... D Appendix E – Existing Signal Timing Sheets ................................................................................................ E Appendix F - Floor & Decor Trip Generation and Parking Study Excerpts…………………………………….F Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - iv - List of Tables Table 1 – Estimated Site-Generated One-Way Trips – Floor & Decor ......................................................... 7 Table 2 – Level-of-Service Criteria for Signalized Intersections ................................................................... 9 Table 3 – Level of Service Criteria for Unsignalized Intersections ............................................................. 10 Table 4 – Intersection LOS Analysis Results – AM Peak Hour .................................................................. 11 Table 5 – Intersection LOS Analysis Results – School PM Peak Hour ...................................................... 12 Table 6 – Intersection LOS Analysis Results – Commuter PM Peak Hour ................................................ 13 Table 7 – Heavy Vehicle Trip Summary ..................................................................................................... 15 Table 8 – Recommendations ...................................................................................................................... 15 List of Figures Figure 1 – Site Location Map ........................................................................................................................ 1 Figure 2 – Site Plan – Floor & Decor Development ...................................................................................... A Figure 3 – Existing and Proposed Study Intersections ................................................................................. C Figure 4 – Existing and Proposed Lane Assignments and Traffic Controls ................................................. C Figure 5 – 2023 Existing Volumes ................................................................................................................ C Figure 6 – 2024 No Build Volumes ............................................................................................................... C Figure 7 – 2029 (No Build + 5 Years) Volumes ............................................................................................ C Figure 8 – Inbound Trip Distribution Percentages – Floor & Decor .............................................................. C Figure 9 – Outbound Trip Distribution Percentages – Floor & Decor ........................................................... C Figure 10 – Development Trips – Floor & Decor .......................................................................................... C Figure 11 – 2024 Build Volumes ................................................................................................................... C Figure 12 – 2029 (Build +5 Years) Volumes ................................................................................................. C Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 1 - I. INTRODUCTION Halff conducted a Traffic Impact Analysis (TIA) on behalf Floor & Decor for a proposed Floor & Decor store to be located in the southwest quadrant of the FM 1709 (Southlake Boulevard) / Kimball Avenue intersection in Southlake, Texas. The development site, covering an area of approximately 8 acres, will contain a 75,000-square foot (sf) Floor & Decor store. Access to the development site will be provided by one existing driveway connection to FM 1709 and two existing connections to Kimball Avenue. Per information provided by the developer, construction of the proposed Floor & Decor store is anticipated to begin in January 2024, with the store scheduled to open in October or November 2024. Figure 1 below shows the location of the proposed development site in relation to FM 1709 and Kimball Avenue. A copy of the development site plan has been included in Appendix A as Figure 2. Screenshot reprinted with permission from Nearmap Aerial Date: January 8, 2023 Figure 1 – Site Location Map FM 1709 Kimball Ave Floor & Decor development site N Village Center Dr Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 2 - II. PURPOSE AND METHODOLOGY The TIA was conducted for submittal to the City of Southlake to support the proposed development of the property. Standard transportation engineering practices were used in conducting the TIA. The TIA examined the projected traffic operations at five study intersections within the study area, including the three existing site access connections that will serve the development site. Halff collected weekday AM, school PM and commuter PM peak period turning movement traffic counts at the five study intersections on Tuesday, May 16 and 23, 2023. Halff also collected 24-hour traffic count data around the loading dock area of the retail building directly east of the subject site (Marshalls and the PGA Superstore). Halff identified the 2023 Existing AM and PM peak hour volumes from the collected traffic counts, and these volumes were then increased by an annual growth rate, based on historical traffic count data and future traffic projections in the study area, to estimate the 2024 No Build and 2029 (No Build + 5 Years) peak hour volumes at the study intersections. Halff generated trips for the proposed Floor & Decor store based on data provided by the developer. These trips were then distributed along the study roadway network, which includes the five study intersections, for the 2024 Build and 2029 (Build + 5 Years) analysis scenarios. The development trips were then added to the 2024 No Build and 2029 (No Build + 5 Years) peak hour volumes to estimate the 2024 Build and 2029 (Build + 5 Years) peak hour volumes passing through the study roadway network. Halff evaluated the AM, school PM and commuter PM peak hour operations at the study intersections for the various analysis scenarios to identify the potential impacts that the development traffic could have on the surrounding roadway network. The TIA also addressed site access and activity around the loading dock of the adjacent retail building. Based on the analyses conducted for the TIA and a review of the development plans, Halff developed recommendations to accommodate projected traffic, where necessary, related to the proposed Floor & Decor store. Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 3 - III. SITE LOCATION / STUDY AREA The proposed Floor & Decor store, covering an area of approximately 8 acres, will be located in the southwest quadrant of the FM 1709 / Kimball Avenue intersection in Southlake, Texas, as shown in Figure 1. The TIA study area includes the following existing intersections with the current traffic controls: • FM 1709 at first retail driveway / median opening west of Kimball Avenue (two-way stop control) • FM 1709 at Kimball Avenue (signalized) • Kimball Avenue at first retail driveway / median opening south of FM 1709 (two-way stop control) • Kimball Avenue at Village Center Drive (two-way stop control) • Village Center Drive at school driveway / retail loading dock driveway (two-way stop control) The location of the proposed Floor & Decor store site and all study intersections, including the type of intersection, to be analyzed in the TIA are shown in Figure 3 in Appendix C. The existing and proposed lane configurations and traffic controls for each intersection to be analyzed in the TIA are shown in Figure 4 in Appendix C. IV. DEVELOPMENT, ZONING, AND SITE ACCESS A. Existing Zoning The development site is currently zoned “B1” – Business Service Park District. B. Existing Development As of June 2023, the proposed development site is vacant and contains natural topography and vegetation. C. Proposed Zoning The developer is proposing to change the site zoning to SP-1 – Detailed Site Plan. D. Proposed Development As mentioned, the proposed development is a 75,000-sf Floor & Decor store. Floor & Decor is a specialty retailer and commercial flooring distributor with locations across the United States. Construction of the proposed store is scheduled to begin in January 2024, with the store scheduled to open in October or November 2024. Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 4 - E. Proposed Site Access Points (Driveways) The proposed Floor & Decor development will utilize three existing driveway / street connections to the adjacent streets for access: • One driveway connection to FM 1709, located at the first median opening west of Kimball Avenue • One driveway connection to Kimball Avenue, at the first median opening south of FM 1709 • One connection to Village Center Drive at the southwest corner of the existing retail building east of the development site (Marshalls / PGA Superstore) o Village Center Drive connects to Kimball Avenue at the second median opening south of FM 1709 All three access connections are existing and currently used to access the retail buildings north and east of the development site. The subject tract is located within the Kimball Oaks retail development. The locations of the site access connections in relation of the development site and connecting roadways are shown in the site plan in Figure 2 in Appendix A. The driveway locations are summarized below: • FM 1709 o Driveway designated “FDD1”; existing driveway located at the first median opening west of Kimball Avenue, 670 feet west of Kimball • Kimball Avenue o Driveway designated “FDD2”; existing driveway located at the first median opening south of FM 1709, 450 feet south of FM 1709 o Village Center Drive; existing intersection located at the second median opening south of FM 1709, 420 feet south of FFD2 • Village Center Drive o Access will be available from the current terminus of Village Center Drive, 650 feet west of Kimball Avenue Internal to the site, the Floor & Decor store will have two driveway connections to the existing north – south drive aisle running through the middle of the existing retail development from FM 1709 to Village Center Drive, as shown on the site plan in Figure 2 in Appendix A. The northern site driveway runs along the front (north) side of the building, and the south driveway runs along the back (south) side. The driveways are connected on the west side of the building, creating a loop around the building, which will be utilized by trucks to access the loading dock area. Trucks will be routed into and out of the site via FM 1709. The south driveway is aligned with the existing driveway serving the Marshalls / PGA Superstore loading dock area, approximately 55 feet north of Village Center Drive. This location falls short of the City’s access spacing standard of 100 feet from Village Center Drive. Halff recommends a variance be granted for this driveway location for the following reasons: • The proposed south driveway aligns with the existing driveway on the east side of the north – south drive aisle. Shifting the south driveway to the north to meet the City’s spacing standard would result in the driveway being offset from the Marshalls / PGA Superstore driveway. • The proposed south driveway is expected to be a low volume driveway, as it runs along the back (south) side of the Floor & Decor building. Customer activity will be focused at the north driveway, which provides direct access to the primary parking lot and the store entrance, both located on the north side of the building. Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 5 - • Trucks serving the Floor & Decor store will enter the Kimball Oaks development from FM 1709, turn into the north Floor & Decor site driveway, circulate counterclockwise around the building to access the loading dock on the south side of the building, and exit the south driveway back to the north towards FM 1709. Shifting the south driveway to the north would impact this proposed truck circulation pattern. • During typical weekday peak hours, development trips accessing the Floor & Decor store from Village Center Drive are expected to be minimal. Halff estimates five (5) percent of the Floor & Decor trips will use Village Center Drive to access the site; the remaining 95 percent of development trips will use the primary Kimball Oaks access connections to FM 1709 and Kimball Avenue to enter and exit the site. With this expected distribution, the number of development trips using the south driveway connection to the north – south drive aisle are expected to be very low, which should have minimal impacts to traffic flow along Village Center Drive. V. EXISTING ROADWAY CONDITIONS FM 1709, which runs in an east - west direction to the north of the development site, is an existing six-lane divided curb-and-gutter facility with a posted speed limit of 45 miles per hour (mph) in the study area. There are sidewalks along both sides of FM 1709. Kimball Avenue, which runs in a north - south direction to the east of the development site, is an existing four-lane divided curb-and-gutter facility with a posted speed limit of 35 mph in the study area. There are sidewalks in place along the west side of Kimball Avenue from FM 1709 to south of the two schools south of the development site, and along the east side of Kimball Avenue from FM 1709 to just north of Village Center Drive. Village Center Drive, which runs in an east – west direction to the southeast of the development site, is an existing three-lane undivided curb-and-gutter facility with an assumed speed limit of 30 mph. It runs from Kimball Avenue west approximately 700 feet to the main north – south drive aisle running through the Kimball Oaks development, with access connections to the Marshalls / PGA Superstore building loading dock area and to Dawson Middle School. There is a 20-mph reduced speed school zone along Village Center Drive that is active from 7:55 to 8:45 am and from 3:30 to 4:10 pm. VI. FUTURE ROADWAY CONDITIONS FM 1709 is identified on the City of Southlake’s Master Thoroughfare Plan (Southlake 2035 Plan), adopted December 7, 2021, as an A6D arterial in 130 to 140 feet of right-of-way (ROW). The road is constructed to its thoroughfare plan standard, and at this time there are no plans for improvements or modifications within the study area. Kimball Avenue is identified on the City’s Thoroughfare Plan as an A4D arterial in 88 feet of ROW. The road is constructed to its thoroughfare plan standard, and at this time there are no plans for improvements or modifications within the study area. Village Center Drive is identified on the City’s Thoroughfare Plan as a C2U collector in 60 feet of ROW. Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 6 - VII. EXISTING TRAFFIC VOLUMES Halff collected weekday AM, school PM and commuter PM peak period turning movement counts (TMCs) at the five existing study intersections on Tuesday, May 16 and 23, 2023, from 7:00 AM to 9:00 AM and from 2:00 PM to 6:00 PM. The traffic count data sheets for the existing study intersections are included in Appendix B. The AM, school PM and commuter PM peak hours for the Floor & Decor development study area were determined by selecting the highest one-hour sum of the total volumes at the five existing intersections. The AM, school PM and commuter PM peak hours observed during the traffic count data collection were calculated to be the following: • AM Peak Hour: 7:45 – 8:45 AM • School PM Peak Hour: 3:00 – 4:00 PM • Commuter PM Peak Hour: 4:45 – 5:45 PM The 2023 Existing peak hour volumes at the existing study intersections are shown in Figure 5 in Appendix C. Halff also collected three (3) days of traffic count data around three locations accessing the loading dock area of the adjacent Marshalls / PGA Superstore retail building. The traffic count data sheets at these three locations are included in Appendix B. Further description of the traffic around the loading dock area is provided in Section XIV. VIII. PROJECTED TRAFFIC VOLUMES A. No Build Volumes To project the 2023 Existing peak hour volumes at the study intersections out to the study years 2024 and 2029, the volumes were first increased by a two percent (2%) annual growth rate, based on historical traffic count data and future traffic projections in the study area (TxDOT Statewide Planning Map), to provide a conservative evaluation of the study intersections for the TIA. The two percent (2%) annual growth rate accounts for general growth in background (non-site) traffic in the study area. The resulting volumes, accounting for background growth at a two percent (2%) annual growth rate, reflect the 2024 No Build and 2029 (No Build + 5 Years) peak hour volumes at the study intersection. These volumes are shown in Figures 6 and 7 in Appendix C. B. Build Volumes To estimate the 2024 Build and 2029 (Build + 5 Years) peak hour volumes at the study intersections, the development trips shown in Figure 10 in Appendix C were added to the 2024 No Build and 2029 (No Build + 5 Years) peak hour volumes shown in Figures 6 and 7. The resulting volumes, which represent the estimated total peak hour volumes at the study intersections for the 2024 Build and 2029 (Build + 5 Years) analysis scenarios, are shown in Figures 11 and 12 in Appendix C. More detailed description of the site generated trips for the proposed Floor & Decor store distributed along the study roadway network is provided in Sections IX., X., and XI. Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 7 - IX. TRIP GENERATION A. Existing Site Trip Generation The proposed Floor & Decor development site is vacant and does not generate any vehicle trips. B. Proposed Site Trip Generation Halff generated development trips for the proposed Floor & Decor store for the 2024 Build and 2029 (Build + 5 Years) analysis scenarios. As previously mentioned in Section IV.D., the proposed development will consist of a 75,000-sf Floor & Decor retail store. Trips were generated using data provided by the developer. The proposed development is unique in nature, in that there is not a comparable land use for which trip generation data is included in the Institute of Transportation Engineers’ Trip Generation Manual, 11th Edition. The closest land use in the manual is “Home Improvement Superstore,” (ITE Code 862). However, this land use accounts for developments selling a much wider variety of home improvement merchandise than the subject development, which focuses on flooring and associated tools and materials. Additionally, the average building size in the “Home Improvement Superstore” land use category is significantly larger than the typical Floor & Decor store, including the proposed Southlake store. Floor and Decor commissioned a trip generation and parking study to collect actual data from existing stores across the country. The study, completed in February 2023, examined nine (9) high-performing stores in November and December 2022, from which weekday AM and PM and Saturday peak hour trip generation rates were derived. The highest peak hour trip generation rates were identified at a store in Woodland Hills, California, and are summarized below: • Weekday AM peak hour – 1.10 trips / 1,000 square feet o 53% inbound / 47% outbound • Weekday PM peak hour – 1.67 trips / 1,000 square feet o 45% inbound / 55% outbound • Saturday peak hour – 1.03 trips / 1,000 square feet Pages from the Floor & Decor trip generation study pertaining to the data used in this report are included in Appendix F. Using this data, Halff generated trips for the proposed store. Table 1 below details the trip generation calculations for the 2024 Build and 2029 (Build + 5 Years) analysis scenarios for the proposed Floor & Decor store. Table 1 – Estimated Site-Generated One-Way Trips – Floor & Decor Land Use (Density) [Trip Generation Data Source] AM Peak Hour of the Adjacent Steet Traffic PM Peak Hour of the Adjacent Steet Traffic Saturday Peak Hour In Out Total In Out Total Total Floor & Decor Store (75,000-sf) [Developer-provided data] 44 39 83 56 69 125 77 No trip reduction factors were applied to the site-generated trips shown in Table 1. Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 8 - Because of the proximity of the development site to two schools (Dawson Middle School and Eubanks Intermediate School), Halff conducted a school PM peak hour analysis of the study intersections, in addition to the typical AM and commuter PM peak hour analyses. Trip generation data for the school peak hour, generally assumed to occur between 2:30 and 4:30 pm (both schools release students at 3:45 pm), was not included as part of Floor & Decor’s February trip generation and distribution study. To present a conservative analysis, Halff used the commuter PM peak hour trips shown in Table 1 for both the commuter PM peak hour analysis and the school PM peak hour analysis. X. TRIP DISTRIBUTION A. General Trip Distribution Percentages General trip distribution percentages for the Floor & Decor development were developed by identifying residential areas near the site and routes to major thoroughfares. The general trip distribution percentages used for the site are summarized below • To / from the west via FM 1709 ........................................................................ 30% • To / from the east via FM 1709 ......................................................................... 25% • To / from the north via Kimball Avenue ............................................................. 20% • To / from the south via Kimball Avenue ............................................................ 25% B. Detailed Trip Distribution Percentages The detailed inbound and outbound trip distribution percentages used for the AM, school PM and commuter PM peak hours at the study intersections for the 2024 Build and 2029 (Build + 5 Years) analysis scenarios are shown in Figures 8 and 9 in Appendix C. XI. TRIP ASSIGNMENT The 2024 Build and 2029 (Build + 5 Years) AM, school PM and commuter PM peak hour development trips for the proposed Floor & Decor store shown in Table 1 were distributed along the study roadway network using the trip distribution percentages shown in Figures 8 and 9. The development trips are shown in Figure 10 in Appendix C. Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 9 - XII. INTERSECTION LOS ANALYSES A. Methodology and Level of Service Evaluations Halff conducted weekday AM, school PM and commuter PM peak hour intersection level-of-service (LOS) analyses at the existing study intersections and at the proposed intersections with the site driveways that will serve the Floor & Decor development for the following analysis scenarios: • 2023 Existing – (existing volumes only) • 2024 No Build – (1-year background growth of existing volumes) • 2029 (No Build + 5 Years) – (6-year background growth of existing volumes) • 2024 Build – (2024 Build projected volumes plus Floor & Decor development trips) • 2029 (Build + 5 Years) – (2029 (No Build + 5 Years) projected volumes plus Floor & Decor development trips) Results of the intersection analyses for unsignalized intersections were generated using the standard procedures outlined in the Transportation Research Board’s (TRB) Highway Capacity Manual, 6th Edition (HCM), through the use of the Trafficware Synchro 11 software package. For the FM 1709 / Kimball Avenue intersection, results of the intersection analyses were generated through Synchro’s Percentile Delay Method to model the existing actuated traffic signal in the TIA study area under varying traffic loads as observed in field conditions. Synchro’s Percentile Delay Method also supports U-turn movements, as observed at the intersection during the traffic data collection, which is not accepted in the HCM 6th Edition methodology. For reference, all Synchro output reports are provided in Appendix D. LOS is described in terms of the average stopped delay experienced per vehicle for a particular movement, approach, or for the entire intersection during a typical morning or afternoon peak hour periods on a given weekday. Separate LOS thresholds are established and outlined for signalized and unsignalized intersections in the HCM. The criteria and descriptions for each LOS threshold established for signalized intersections in the HCM are provided in Table 2. The criteria and description for each LOS threshold for unsignalized intersections are provided in Table 3. Table 2 – Level-of-Service Criteria for Signalized Intersections Level of Service Description Average Stopped Delay (sec/veh) A Little to no delays experienced at the intersection and vehicle progression is exceptionally favorable. Majority of vehicles arrive during the green indication and travel through the intersection without stopping. <10.0 B Light delays are experienced at the intersection and vehicle progression is highly favorable. Most vehicles pass through the intersection, with slightly higher stopped vehicles than with LOS A. > 10.0 & 20.0 C Moderate delays are experienced at the intersection and vehicle progression is favorable. Individual cycle failures may begin to appear. The number of vehicles stopping is significant, although many vehicles still clear the intersection within one cycle. > 20.0 & 35.0 D Moderate to heavy delays are experienced at the intersection and progression is ineffective. Many vehicles stop and individual cycle failures are noticeable. > 35.0 & 55.0 E Heavy delays are experienced at the intersection and progression is unfavorable. Individual cycle failures are frequent. > 55.0 & 80.0 F Excessive delays experienced at the intersection and vehicle progression is very poor. Most cycles fail to clear the queue. > 80.0 Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 10 - Table 3 – Level of Service Criteria for Unsignalized Intersections Level of Service Description Average Stopped Delay (sec/veh) A Little to no delays experienced at stopped movement; free-flow conditions 10.0 B Light delays experienced at stopped movement indicative to free-flow conditions > 10.0 and 15.0 C Moderate delays experienced at stopped movement influence of traffic density on operations becomes marked > 15.0 and 25.0 D Moderate to heavy delays at the stopped movement ability to maneuver is severely restricted due to congestion > 25.0 and 35.0 E Heavy delays experienced at stopped movement; operations are at or near capacity and are unstable > 35.0 and 50.0 F* Excessive delays experienced at stopped movements; forced flow or breakdown characterized by queues > 50.0 Note: * - LOS F is assigned to a movement with a volume-to-capacity ratio greater than 1.0, regardless of the average stopped delay. The 2023 Existing traffic volume intersection analyses were conducted using the existing lane assignments and traffic controls at the existing study intersections shown in Figure 4 in Appendix C and the 2023 Existing AM and PM peak hour volumes shown in Figure 5 in Appendix C. The peak hour factor (PHF) for each existing study intersection was calculated based on the total traffic volumes passing through each individual intersection (intersection PHF) during the AM and PM peak hours. The heavy vehicle percentage (HV%) for each movement at the existing study intersections were set to the actual field HV% from the collected traffic data. For movements where the actual field HV% was lower than the HCM default value of 3%, the HV% was set at 3%. Signal timing parameters for the FM 1709 / Kimball Avenue signalized intersection are based on the existing traffic signal timing sheets acquired from TxDOT, which are included in Appendix E. The 2024 No Build and Build traffic volume intersection analyses were conducted using the existing lane assignments and traffic controls at the study intersections shown in Figure 4 in Appendix C and the 2024 No Build and Build AM and PM peak hour volumes shown in Figures 6 and 11 in Appendix C. Halff used the same intersection PHF and HV% values as in the 2023 Existing analysis scenarios. The 2029 (No Build + 5 Years) and (Build + 5 Years) traffic volume intersection analyses were conducted using the existing lane assignments and traffic controls at the study intersections shown in Figure 4 in Appendix C and the 2029 (No Build + 5 Years) and (Build + 5 Years) AM and PM peak hour volumes shown in Figures 7 and 12 in Appendix C. Halff used the same intersection PHF and HV% values as in the 2023 Existing analysis scenarios. The intersection analysis results for the AM, school PM and commuter PM peak hours are shown in Tables 4, 5 and 6. The unsignalized intersection analysis results represent the critical minor movements or approaches for each intersection operating as a two-way stop-control intersection. Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 11 - Table 4 – Intersection LOS Analysis Results – AM Peak Hour Intersection (Signalized / TWSC) Overall / Approach / Movement 2023 Existing 2024 No Build 2024 Build 2029 (No Build + 5 Years) 2029 (Build + 5 Years) AM AM AM AM AM Delay LOS Delay LOS Delay LOS Delay LOS Delay LOS 1 FM 1709 at Kimball Avenue (Signalized) Overall 44.5 D 45.6 D 46.0 D 65.1 E 66.4 E EB 41.4 D 43.1 D 43.7 D 82.2 F 84.8 F WB 36.5 D 37.4 D 38.2 D 42.4 D 43.4 D NB 57.7 E 57.0 E 57.0 E 54.0 D 53.9 D SB 49.9 D 50.8 D 50.8 D 53.7 D 53.7 D 2 S. Kimball Avenue at Kimball Oaks Drwy / Primrose School Drwy (TWSC) NBL 8.9 A 8.9 A 9.1 A 9.2 A 9.3 A EBL/T 28.1 D 29.0 D 34.3 D 35.3 E 42.5 E EBR 10.2 B 10.3 B 10.3 B 10.5 B 10.6 B WBL/T/R 13.7 B 13.9 B 14.2 B 15.4 C 15.8 C SBL 9.2 A 9.3 A 9.3 A 9.6 A 9.6 A 3 S. Kimball Avenue at Village Center Drive (TWSC) NBL 9.8 A 9.8 A 9.9 A 10.3 B 10.4 B EBL 58.9 F 67.2 F 72.9 F 129.0 F 144.6 F EBR 12.0 B 12.2 B 12.3 B 12.9 B 13.1 B 4 FM 1709 at Kimball Oaks Drwy / Southlake Corners Drwy (TWSC) NBL/T * F * F * F * F * F NBR 25.9 D 26.7 D 27.0 D 32.1 D 32.5 D EBL 17.4 C 17.8 C 17.8 C 20.2 C 20.2 C WBL 59.1 F 64.6 F 67.9 F 104.6 F 112.3 F SBL/T 167.7 F 192.1 F 201.9 F * F * F SBR 15.4 C 15.6 C 15.6 C 16.9 C 16.9 C 5 Village Center Drive at Kimball Oaks Drwy / Dawson MS Drwy (TWSC) NBL/T/R 16.9 C 17.7 C 18.0 C 22.3 C 22.7 C EBL 7.2 A 7.2 A 7.2 A 7.2 A 7.2 A WBL 8.3 A 8.4 A 8.4 A 8.5 A 8.6 A SBL/T/R 0.0 A 0.0 A 0.0 A 0.0 A 0.0 A Note: * - Delay exceeds 300 seconds Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 12 - Table 5 – Intersection LOS Analysis Results – School PM Peak Hour Intersection (Signalized / TWSC) Overall / Approach / Movement 2023 Existing 2024 No Build 2024 Build 2029 (No Build + 5 Years) 2029 (Build + 5 Years) School PM School PM School PM School PM School PM Delay LOS Delay LOS Delay LOS Delay LOS Delay LOS 1 FM 1709 at Kimball Avenue (Signalized) Overall 53.2 D 54.6 D 54.9 D 68.7 E 69.3 E EB 45.5 D 46.6 D 47.1 D 55.7 E 55.7 E WB 51.4 D 54.1 D 54.6 D 80.6 F 82.7 F NB 69.0 E 69.6 E 68.6 E 75.3 E 74.2 E SB 60.3 E 60.8 E 60.8 E 67.7 E 67.5 E 2 S. Kimball Avenue at Kimball Oaks Drwy / Primrose School Drwy (TWSC) NBL 9.1 A 9.1 A 9.3 A 9.4 A 9.6 A EBL/T 78.6 F 88.8 F 172.1 F 186.9 F * F EBR 10.4 B 10.4 B 10.6 B 10.7 B 10.9 B WBL/T/R 12.3 B 12.4 B 12.7 B 13.2 B 13.5 B SBL 9.9 A 10.0 B 10.0 B 10.5 B 10.5 B 3 S. Kimball Avenue at Village Center Drive (TWSC) NBL 9.3 A 9.3 A 9.4 A 9.7 A 9.8 A EBL 38.6 E 41.3 E 46.0 E 65.0 F 74.8 F EBR 11.1 B 11.1 B 11.3 B 11.6 B 11.8 B 4 FM 1709 at Kimball Oaks Drwy / Southlake Corners Drwy (TWSC) NBL/T * F * F * F * F * F NBR 26.0 D 27.2 D 27.7 D 35.8 E 36.8 E EBL 52.1 F 57.2 F 57.2 F 105.8 F 105.8 F WBL 35.7 E 38.0 E 39.9 E 56.6 F 61.1 F SBL/T * F * F * F * F * F SBR 31.5 D 33.2 D 33.2 D 44.5 E 44.5 E 5 Village Center Drive at Kimball Oaks Drwy / Dawson MS Drwy (TWSC) NBL/T/R 10.9 B 10.9 B 11.1 B 11.5 B 11.6 B EBL 7.3 A 7.3 A 7.4 A 7.4 A 7.4 A WBL 7.8 A 7.8 A 7.8 A 7.8 A 7.9 A SBL/T/R 18.1 C 18.4 C 19.0 C 21.8 C 22.4 C Note: * - Delay exceeds 300 seconds Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 13 - Table 6 – Intersection LOS Analysis Results – Commuter PM Peak Hour Intersection (Signalized / TWSC) Overall / Approach / Movement 2023 Existing 2024 No Build 2024 Build 2029 (No Build + 5 Years) 2029 (Build + 5 Years) Commuter PM Commuter PM Commuter PM Commuter PM Commuter PM Delay LOS Delay LOS Delay LOS Delay LOS Delay LOS 1 FM 1709 at Kimball Avenue (Signalized) Overall 80.2 F 84.1 F 84.9 F 107.2 F 108.0 F EB 56.9 E 58.5 E 58.5 E 68.5 E 68.7 E WB 112.2 F 119.7 F 122.2 F 160.0 F 162.5 F NB 72.0 E 73.6 E 73.2 E 84.5 F 84.1 F SB 65.0 E 67.7 E 67.5 E 90.1 F 89.8 F 2 S. Kimball Avenue at Kimball Oaks Drwy / Primrose School Drwy (TWSC) NBL 8.5 A 8.5 A 8.6 A 8.7 A 8.8 A EBL/T 37.0 E 39.1 E 55.6 F 60.6 F 99.1 F EBR 9.6 A 9.6 A 9.7 A 9.8 A 9.8 A WBL/T/R 15.8 C 16.0 C 16.5 C 18.7 C 19.4 C SBL 9.6 A 9.7 A 9.7 A 10.2 B 10.2 B 3 S. Kimball Avenue at Village Center Drive (TWSC) NBL 8.3 A 8.3 A 8.4 A 8.5 A 8.5 A EBL 17.5 C 17.8 C 18.4 C 19.8 C 20.5 C EBR 9.7 A 9.7 A 9.8 A 9.9 A 9.9 A 4 FM 1709 at Kimball Oaks Drwy / Southlake Corners Drwy (TWSC) NBL/T * F * F * F * F * F NBR 27.1 D 28.3 D 28.9 D 37.8 E 38.9 E EBL 93.8 F 107.6 F 107.6 F 240.1 F 240.1 F WBL 35.4 E 37.6 E 39.4 E 55.2 F 57.9 F SBL/T * F * F * F * F * F SBR 41.6 E 44.3 E 44.3 E 65.9 F 65.9 F 5 Village Center Drive at Kimball Oaks Drwy / Dawson MS Drwy (TWSC) NBL/T/R 8.4 A 8.4 A 8.4 A 8.4 A 8.4 A EBL 0.0 A 0.0 A 0.0 A 0.0 A 0.0 A WBL 7.2 A 7.2 A 7.3 A 7.2 A 7.3 A SBL/T/R 0.0 A 0.0 A 0.0 A 0.0 A 0.0 A Note: * - Delay exceeds 300 seconds B. Summary of Intersection LOS Analyses Results The results of the peak hour intersection analyses shown in Tables 4 - 6 indicate that the proposed Floor & Decor store is not projected to impact the peak hour operations of the study intersection. The addition of trips generated by the proposed development does not change the LOS from the No Build to the Build scenarios, with only one exception: • Kimball Ave at the Kimball Oaks driveway - Commuter PM peak hour – the eastbound left / through movement is projected to decrease from a LOS E to F from the 2024 No Build to the 2024 Build scenario o It should be noted that this movement currently operates at a LOS E, and is projected to operate at a LOS F in the 2029 (No Build + 5 Years) and 2029 (Build + 5 Years) scenarios All other movements at the study intersections are projected to maintain their LOS from the No Build to the Build scenarios. Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 14 - XIII. SITE ACCESS EVALUATION As mentioned, the development site will be accessible from three existing driveway connections to adjacent streets. The existing driveway connection to FM 1709 at the first median opening west of Kimball Avenue will provide access to the north – south drive aisle running along the east side of the building. The existing driveway connection to Kimball Avenue at the first median opening south of FM 1709 will provide access to the east – west drive aisle that connects to the aforementioned north – south drive aisle. Access will also be available from Village Center Drive via its connection with the north – south drive aisle at the southeast corner of the subject tract (southwest corner of the Marshalls / PGA Superstore building). The Floor & Decor building will be oriented to face FM 1709, with two driveway connections to the existing north – south drive aisle on the east side of the building. All three connection points providing access to the site from FM 1709 and Kimball Avenue have the following characteristics: • Left and right turn deceleration lanes along the major street • Two-lane approaches to the major street • Stop control on the approaches to the major street These driveways currently provide access to the Kimball Oaks retail development which surrounds the north and east sides of the Floor & Decor site. The south connection, Village Center Drive, also provides access to the student drop off / pick up area for Dawson Middle School via the driveway intersection 350 feet west of Kimball Avenue, across from the driveway accessing the loading dock area of the Marshalls / PGA Superstore building. XIV. LOADING DOCK EVALUATION The proposed Floor & Decor building orientation has the loading dock on the south side of the building. The proposed truck route to / from the loading dock, as shown on Figure 2 (Site Plan) in Appendix A, has trucks entering the Kimball Oaks development at the driveway connection to FM 1709, traveling south along the north – south drive aisle to the northern Floor & Decor driveway, turning right (west) into the north driveway, looping counterclockwise around the building, and backing into the dock on the south side of the building. Exiting the store, trucks will turn left (north) from the southern Floor & Decor driveway onto the north – south drive aisle, and travel north along the drive aisle to the driveway connection to FM 1709. Halff collected three (3) days of traffic counts at the access connections to the loading dock area on the south side of the Marshalls / PGA Superstore building, to identify current heavy vehicle activity in this area. Table 7 provides a summary of the heavy vehicle trip activity at the access connections to the retail building loading dock. In this case, “heavy vehicles” are defined as buses, single-unit trucks and semi-trucks. Because this area is adjacent to the primary access point to Dawson Middle School, Halff identified the heavy vehicles passing through the area during the school’s AM and PM peak periods, defined to be 7:00 – 9:00 am and 2:30 – 4:30 pm (school hours are 8:00 am to 3:45 pm). The heavy vehicle trip volumes shown in Table 7 are the total volumes compiled across the three days of data collection. Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - 15 - Table 7 – Heavy Vehicle Trip Summary Location AM Peak Period HV trips School PM Peak Period HV trips Total HV trips Kimball Avenue / Kimball Oaks driveway* 4 5 44 Village Center Drive / school driveway / loading dock south driveway 2 6 48 Village Center Drive / loading dock west driveway 0 4 16 * Heavy vehicles at this location could be serving other retail tenants in the Kimball Oaks development As shown in Table 7 above, a total of 108 heavy vehicle trips were observed across the three days that traffic count data was collected, an average of 36 heavy vehicle trips per day. Since each trip represents a one-way movement, either in to or out of the development, this equates to 18 heavy vehicles entering and exiting the Kimball Oaks site each day. Of the 108 heavy trips counted in this area, 14 were observed entering and exiting the Dawson MS site from Village Center Drive. It is important to note that the trips observed at the Kimball Avenue / Kimball Oaks driveway intersection cannot all be assumed to be associated with the Marshalls / PGA Superstore building, as there are seven other retail buildings within the Kimball Oaks that could be served by some of the truck traffic entering / exiting the site at this location. Table 7 also shows that heavy vehicle activity during the school AM and PM peak periods is minimal. An average of 2 heavy vehicle trips during the AM peak period and 5 heavy vehicle trips during the school PM peak period were observed across the three-day count duration. One of the AM peak period trips was associated with the school. As discussed in the previous section, the proposed truck routing plan for the Floor & Decor store does not utilize Village Center Drive for truck access. Instead, trucks are routed in and out of the site via the north – south drive aisle connection to FM 1709. XV. RECOMMENDATIONS Based on the analyses conducted for the TIA and a review of the development plans, Table 8 below provides recommendations to accommodate projected traffic, where necessary, related to the proposed Floor & Decor store in Southlake, Texas. Table 8 – Recommendations Study Year Recommendation Responsible Party 2024 Work with store management to schedule heavy vehicle activity outside of school AM and PM peak periods Developer 2024 Maintain clear sight visibility around the site driveway approaches to the north – south drive aisle running along the east side of the development Developer 2024 Install stop signs and stop bars at the eastbound site driveway approaches to the north – south drive aisle running along the east side of the development. Developer 2024 Grant a variance for the location of the proposed south site driveway connection to the north – south drive aisle, with respect to its proximity to Village Center Drive City Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - A - Appendix A – Site Plan – Floor & Decor Development 339,859 SQ. FT.OR7.802 ACRES(REMAINDER OF ACALLED 11.208 ACRE TRACT)GREENWAY-1709/ELEVENPARTNERS, L.P.INST. NO D197109628FLOOR & DECOR1 STORY75,078 SF.FF = 629.502298438121261041212FLOOR & DECOR 1 STORY 75,078 SF. FF = 629.50 PRELIMINARY MATTHEW J. GARDNER 130786 P.E. NO. 6/22/23DATE THESE DOCUMENTS ARE FOR INTERIM REVIEW AND NOT INTENDED FOR REGULATORY APPROVAL, PERMIT, BIDDING OR CONSTRUCTION PURPOSES. THEY WERE PREPARED BY OR UNDER THE SUPERVISION OF: NAME FOR INTERIM REVIEW ONLY TBPE FIRM #F-312 FILE NAME: A:\54000s\54063\001\LD\CADD\Sheets\Exhibits\EXBT-AUTOTURN-54063.dwg DATE: June 22, 2023, TIME: 4:30 PM, USER: ah2780 AVO: XXXXXSHEET TITLE CHECKED BY: DRAWN BY: PROJECT NO.: ISSUED: SCALE:NO.DATEDESCRIPTIONREVISION54063 JUNE, 2023 CAD MJG AS SHOWN1201 NORTH BOWSER RD.RICHARDSON, TEXAS 75081-2275TEL. (214) 346-6200FLOOR & DECORSOUTHLAKE, TEXASTARRENT COUNTYN 1 AUTO TURN EXHIBIT 0 60'120' GRAPHIC SCALE - 1"=60' FIGURE 1 SITE PLAN FIGURE 2 SITE PLAN Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - B - Appendix B – Traffic Count Data GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ KIMBALL AVE - 2NDSTUDYSite Code:Start Date: 05/23/2023Page No: 1Turning Movement DataStart TimeKIMBALL AVEFM 1709KIMBALL AVEFM 1709SouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total7:00 AM40327010143687132010832241000663832511003746917:15 AM2534920015199211101131923300454037021104327417:30 AM4348950018611113190014330481500934338224014498717:45 AM4666131002432413520101802958121521004739172105111034Hourly Total1541803881072350427634054411015340152304168146812821176633378:00 AM4778123102492515530302135474230015162318950047510888:15 AM577399012291413731101837293260019160381541049610998:30 AM40481230021110146282018635541000994242031004939898:45 AM3850141002291615824101992842180088523062010379895Hourly Total1822494861191865596113707811892637700529216142520020184340719:00 AM0000000000000000000000000*** BREAK ***-------------------------Hourly Total00000000000000000000000002:00 PM3460113002072329178103935546181012060310362040811282:15 PM3444116001942529566103874956251013152249254033010422:30 PM3746142022252328270103765571210014749279281035711052:45 PM284812200198243286120415525732001415025731303411095Hourly Total1331984930282495119627550157121123096205392111095120100143643703:00 PM3353128002142131262103965448120011457294373039111153:15 PM3446105211872728654003675552280013554307401040210913:30 PM3359109002012528686103984658300013465289601041511483:45 PM428712400253222995000371757628001796229542404031206Hourly Total142245466218559511832522015322302349800562238118517990161145604:00 PM34601151121033321664042472100360020858282284037212144:15 PM3249137102192530562103934478330015542294230035911264:30 PM3253143002282731268204095675190015055301253038411714:45 PM277313302233363597010466518228011616533034234311291Hourly Total12523552823890121129726680169222333511601674220120711093154648025:00 PM44491340022729347581143582126311024067336171042113235:15 PM4538125002082340177025016496221018371399261049713895:30 PM4166136002432838692105075677190015267328252042213245:45 PM334410200179222755210350506218001306031718303981057Hourly Total16319749700857102140927933179325236190207052651380867017385093Grand Total8991304285867506752861081248293791312151576517553331313187760823394994026233Approach %17.725.756.40.1--6.777.215.80.4--36.747.615.60.2--13.378.18.30.4---Total %3.45.010.90.0-19.32.023.34.80.1-30.24.66.02.00.0-12.65.029.63.10.1-37.9-Lights873128228246-49855226053124229-7846120015405105-32551301763980139-978025866% Lights97.198.398.8100.0-98.498.999.199.5100.0-99.298.897.798.6100.0-98.298.798.497.3100.0-98.498.6 Mediums2521270-7364330-52123270-511098220-130306% Mediums2.81.60.90.0-1.41.10.70.20.0-0.71.02.01.40.0-1.50.81.32.70.0-1.31.2Articulated Trucks1170-901230-153400-772300-3061% ArticulatedTrucks0.10.10.20.0-0.20.00.20.20.0-0.20.20.30.00.0-0.20.50.30.00.0-0.30.2Bicycles onCrosswalk----2-----0-----0-----1--% Bicycles onCrosswalk----28.6-----0.0-----0.0-----25.0--Pedestrians----5-----3-----53-----3--% Pedestrians----71.4-----100.0-----100.0-----75.0-- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ KIMBALL AVE - 2NDSTUDYSite Code:Start Date: 05/23/2023Page No: 305/23/2023 7:00 AMEnding At05/23/2023 6:00 PMLightsMediumsArticulated TrucksBicycles on CrosswalkPedestriansKIMBALL AVE [N]OutInTotal4089498590744573118149230000004148506792152824128287360272125007110000002000052858130489967RTLUP9205 0 0 24 130 9051 Out 7913 0 0 15 52 7846 In 17118 0 0 39 182 16897 Total FM 1709 [E] R 1248 0 0 3 3 1242 T 6108 0 0 12 43 6053 L 528 0 0 0 6 522 U 29 0 0 0 0 29 P 3 3 0 0 0 0 2610325558654951100178000000266033135973OutInTotalKIMBALL AVE [S]ULTRP51200154051000123270034000000000005351215157651753FM 1709 [W]Total19896212520020160In978013030009940Out101168222001022039000039U1301107001318L76399823007760T80122000823R000134PTurning Movement Data Plot GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ KIMBALL AVE - 2NDSTUDYSite Code:Start Date: 05/23/2023Page No: 4Turning Movement Peak Hour Data (7:45 AM)Start TimeKIMBALL AVEFM 1709KIMBALL AVEFM 1709SouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total7:45 AM46661310024324135201018029581215210047391721051110348:00 AM4778123102492515530302135474230015162318950047510888:15 AM577399012291413731101837293260019160381541049610998:30 AM4048123002111014628201863554100099424203100493989Total1902654761193273573109707621902797115254121115102522019754210Approach %20.428.451.10.1--9.675.214.30.9--35.151.613.10.2--10.776.512.80.1---Total %4.56.311.30.0-22.11.713.62.60.2-18.14.56.61.70.0-12.95.035.96.00.0-46.9-PHF0.8330.8490.9080.250-0.9360.7300.9240.8790.583-0.8940.6600.7500.6830.250-0.7080.8510.8990.6630.500-0.9660.958Lights1822594711-913725591097-747189274701-53420814802452-19354129% Lights95.897.798.9100.0-98.098.697.6100.0100.0-98.099.598.298.6100.0-98.798.698.097.2100.0-98.098.1Mediums8640-1811300-141410-632570-3573% Mediums4.22.30.80.0-1.91.42.30.00.0-1.80.51.41.40.0-1.11.41.72.80.0-1.81.7Articulated Trucks0010-10100-10100-10500-58% ArticulatedTrucks0.00.00.20.0-0.10.00.20.00.0-0.10.00.40.00.0-0.20.00.30.00.0-0.30.2Bicycles onCrosswalk----0-----0-----0-----0--% Bicycles onCrosswalk----0.0-----------0.0--------Pedestrians----1-----0-----52-----0--% Pedestrians----100.0-----------100.0-------- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ KIMBALL AVE - 2NDSTUDYSite Code:Start Date: 05/23/2023Page No: 5Peak Hour Data05/23/2023 7:45 AMEnding At05/23/2023 8:45 AMLightsMediumsArticulated TrucksBicycles on CrosswalkPedestriansKIMBALL AVE [N]OutInTotal5929131505718251120000006009321532471259182104680010000000000000147626519011RTLUP1778 0 0 5 34 1739 Out 762 0 0 1 14 747 In 2540 0 0 6 48 2486 Total FM 1709 [E] R 109 0 0 0 0 109 T 573 0 0 1 13 559 L 73 0 0 0 1 72 U 7 0 0 0 0 7 P 0 0 0 0 0 0 5775341111146200110000005915411132OutInTotalKIMBALL AVE [S]ULTRP118927470001410001000000000005211902797152FM 1709 [W]Total3156537003216In1935355001975Out1221182001241200002U2083000211L1480255001510T2457000252R000000PTurning Movement Peak Hour Data Plot (7:45 AM) GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ KIMBALL AVE - 2NDSTUDYSite Code:Start Date: 05/23/2023Page No: 6Turning Movement Peak Hour Data (4:45 PM)Start TimeKIMBALL AVEFM 1709KIMBALL AVEFM 1709SouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total4:45 PM2773133022333635970104665182280116165330342343112915:00 PM44491340022729347581143582126311024067336171042113235:15 PM4538125002082340177025016496221018371399261049713895:30 PM416613600243283869210507567719001526732825204221324Total1572265280291111614932973319092533811002173627013931026317715327Approach %17.224.858.00.0--6.178.215.60.2--34.451.813.60.3--15.278.75.80.3---Total %2.94.29.90.0-17.12.228.05.60.1-35.84.77.21.90.0-13.85.126.11.90.1-33.2-PHF0.8720.7740.9710.000-0.9370.8060.9310.8070.750-0.9410.7710.7560.8060.500-0.7670.9510.8730.7500.750-0.8910.959Lights1562245270-90711514842953-1897250381972-73026713831006-17565290% Lights99.499.199.8--99.699.199.499.3100.0-99.498.8100.097.0100.0-99.298.999.398.0100.0-99.299.3Mediums1200-31600-72030-51420-722% Mediums0.60.90.0--0.30.90.40.00.0-0.40.80.03.00.0-0.70.40.32.00.0-0.40.4Articulated Trucks0010-10320-51000-12600-815% ArticulatedTrucks0.00.00.2--0.10.00.20.70.0-0.30.40.00.00.0-0.10.70.40.00.0-0.50.3Bicycles onCrosswalk----0-----0-----0-----0--% Bicycles onCrosswalk----0.0-----0.0-----0.0-----0.0--Pedestrians----2-----3-----1-----3--% Pedestrians----100.0-----100.0-----100.0-----100.0-- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ KIMBALL AVE - 2NDSTUDYSite Code:Start Date: 05/23/2023Page No: 7Peak Hour Data05/23/2023 4:45 PMEnding At05/23/2023 5:45 PMLightsMediumsArticulated TrucksBicycles on CrosswalkPedestriansKIMBALL AVE [N]OutInTotal94390718501344150000009489111859527224156000210010000000000000252822615702RTLUP1653 0 0 6 8 1639 Out 1909 0 0 5 7 1897 In 3562 0 0 11 15 3536 Total FM 1709 [E] R 297 0 0 2 0 295 T 1493 0 0 3 6 1484 L 116 0 0 0 1 115 U 3 0 0 0 0 3 P 3 3 0 0 0 0 441730117155100110000004467361182OutInTotalKIMBALL AVE [S]ULTRP22503819700203001000000000000122533811001FM 1709 [W]Total40231513004051In175678001771Out226785002280600006U2671200270L138346001393T1002000102R000033PTurning Movement Peak Hour Data Plot (4:45 PM) GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ NE DWY -TUESSite Code:Start Date: 05/23/2023Page No: 1Turning Movement DataStart TimeKIMBALL AVESCHOOL DWYKIMBALL AVENE DWYSouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total12:00 AM050106000000020002000000812:15 AM010001000000050005000000612:30 AM000000000000000000000000012:45 AM0000000000000000000000000Hourly Total060107000000070007000000141:00 AM03000300000000000000000031:15 AM04000400000001000100000051:30 AM01000100000001000100000021:45 AM0000000000000000000000000Hourly Total080008000000020002000000102:00 AM00000000000000000000000002:15 AM01000100000000000000000012:30 AM00000000000000000000000002:45 AM0000000000000100010000001Hourly Total01000100000001000100000023:00 AM00000000000000000000000003:15 AM00000000000000000000000003:30 AM00000000000000000000000003:45 AM0000000000000100010010012Hourly Total00000000000001000100100124:00 AM00000000000000000000000004:15 AM01000100000000000000000014:30 AM04000400000002000200000064:45 AM05110700000014000500000012Hourly Total01011012000000160007000000195:00 AM143008001001040004000000135:15 AM0050050000003800011100001175:30 AM050015000000160007000000125:45 AM0120001210000116100800000021Hourly Total1218013010100252410030100001636:00 AM02010021000000071008000000296:15 AM2212102600000001000010602008446:30 AM4340103900101102900029502007766:45 AM330321380010013350003800200279Hourly Total910564112400201238110085110600172287:00 AM73832050008008241300461010021067:15 AM65250063205007122500284000041027:30 AM2262222882014001616820071310024179 7:45 AM1413393215950130018682400921030514273Hourly Total49285197436090400049102131400237914053146608:00 AM81674201812010001241293001361010123318:15 AM141218001432017001941496001592030053268:30 AM870860921090010368000711000011748:45 AM46810608810300447520081400004177Hourly Total344263014050460390045154211100447804011210089:00 AM56793084205007770400814020061789:15 AM772120091006006186520085190700262089:30 AM466244098106007355000583030061699:45 AM66116408700600666000066401005164Hourly Total2226661110360302300263425060029030013004371910:00 AM651123072002002769000761305001816810:15 AM54112906700600626800070825001515810:30 AM1682690104004014756200651629002720010:45 AM15619408000100111821109523070030206Hourly Total1321669250323001301132727531030660426009073211:00 AM188257112100100110930101041907002625211:15 AM472358011900400471020001091708002525711:30 AM07835100123003003149210010722013013526811:45 AM470468012800400412104010117430140057306Hourly Total9308141331491001200124339112043710104201143108312:00 PM1080361201380090092813310016229115004535412:15 PM18144130139003003159011010741016005730612:30 PM69825901380070071411610013132022005433012:45 PM689271201340070071392100106360190055302Hourly Total2334813246054900260026704314105061381720021112921:00 PM110023140138008008786000934501400592981:15 PM2772190109001001988100983501201472551:30 PM3832360115106007989010994311801622831:45 PM363264096003003107720089232150040228Hourly Total93239333045810180019353403103791463590220810642:00 PM3971941123101002581020883101000412542:15 PM67114709800300368810095170700242202:30 PM27223501021070083102010106270700342502:45 PM468276110500300389200010022090031239Hourly Total1530883222428201400162236313038997033001309633:00 PM7752491115102003985000942701000372493:15 PM579237011400800858220089250700322433:30 PM71072730144201100131180500963001600462993:45 PM3116354215800503515158100174260260052389Hourly Total2237710923353130260329404058004531080590016711804:00 PM117725801210010001061531001601901200313224:15 PM86619409720903116103410114200700272494:30 PM86824711072010001271164001271601300292754:45 PM10953260143701200196124710138210120033333Hourly Total37306100251468110410352254961620539760440012011795:00 PM1181112010520140016181703101921501200273405:15 PM86619109430120015111273101422901400432945:30 PM197624401234018002213103300119180500232875:45 PM36017508540801121492101107200110031235Hourly Total412837112040713052016556492102156082042001241156 6:00 PM25517307700900978010088240500292036:15 PM241234070107008577100832001600361976:30 PM05422808400100197200081250901342006:45 PM150191071002002114400055310100041169Hourly Total5200811603021019002032273200307100040011407697:00 PM069178094000000873020832801200402177:15 PM037176060000000114700058230500281467:30 PM1388405100000085500063250401291437:45 PM1479506200100194600055330130046164Hourly Total21915123026700100136221020259109034011436708:00 PM1383304500000024400046170800251168:15 PM023940361010022310103419070026988:30 PM126710350010016310003714020016898:45 PM02064030000000027000271904002380Hourly Total210725120146102003101330101446902100903839:00 PM031250380000001140001512060018719:15 PM029020310000000180001812070019689:30 PM0140301700000011600017302005399:45 PM017000170000000130001340100535Hourly Total09121001030000002610006331016004721310:00 PM02000020000000014000141020033710:15 PM01500015000000011000111010022810:30 PM010000100010010700073030062410:45 PM0170001700000006000640200629Hourly Total0620006200100103800038908001711811:00 PM020002000000011000110000001311:15 PM0700070000000900090000001611:30 PM0701080000000300030000001111:45 PM0400040000000400040000008Hourly Total020010210000000270002700000048Grand Total2934268108231913596251033009381466495281151551411859524059171813575Approach %4.971.618.15.4--13.40.086.60.0--8.589.81.50.3--69.00.530.50.0---Total %2.231.48.02.3-43.90.40.02.40.0-2.83.436.50.60.1-40.68.70.13.90.0-12.7-Motorcycles0400-40000-00600-60000-010% Motorcycles0.00.10.00.0-0.10.0-0.0--0.00.00.10.00.0-0.10.00.00.0--0.00.1Cars & Light Goods28641891079316-58704903250-37446348347915-5391118295190-171013345% Cars & LightGoods97.698.199.799.1-98.596.1-98.5--98.299.497.697.5100.0-97.899.7100.099.0--99.598.3Buses64000-461030-406000-600000-0110% Buses2.00.90.00.0-0.82.0-0.9--1.00.01.20.00.0-1.10.00.00.0--0.00.8Single-Unit Trucks12631-311020-323820-422050-783% Single-UnitTrucks0.30.60.30.3-0.52.0-0.6--0.80.40.82.50.0-0.80.20.01.0--0.40.6Articulated Trucks0902-110000-011400-151000-127% ArticulatedTrucks0.00.20.00.6-0.20.0-0.0--0.00.20.30.00.0-0.30.10.00.0--0.10.2Bicycles onCrosswalk----0-----0-----0-----4--% Bicycles onCrosswalk----0.0-----0.0-----0.0-----6.8--Pedestrians----13-----9-----1-----55--% Pedestrians----100.0-----100.0-----100.0-----93.2-- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ NE DWY -TUESSite Code:Start Date: 05/23/2023Page No: 405/23/2023 12:00 AMEnding At05/24/2023 12:00 AMMotorcyclesCars & Light GoodsBusesSingle-Unit TrucksOtherKIMBALL AVE [N]OutInTotal6410665758701252763461094331741711286786596212748040001079418928631600406003261100902131082426829331913RTLUP383 0 3 6 374 0 Out 381 0 3 4 374 0 In 764 0 6 10 748 0 Total SCHOOL DWY [E] R 330 0 2 3 325 0 T 0 0 0 0 0 0 L 51 0 1 1 49 0 U 0 0 0 0 0 0 P 9 9 0 0 0 0 461047725391101634160101324274915244858551410372OutInTotalKIMBALL AVE [S]ULTRP00600154634834790006000023820011401154664952811NE DWY [W]Total0325201223266In017100711718Out015420511548000000U011820211185L090009T0519050524R00005959PTurning Movement Data Plot GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ NE DWY -TUESSite Code:Start Date: 05/23/2023Page No: 5Turning Movement Peak Hour Data (7:30 AM)Start TimeKIMBALL AVESCHOOL DWYKIMBALL AVENE DWYSouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total7:30 AM22622228820140016168200713100241797:45 AM14133932159501300186824009210305142738:00 AM81674201812010001241293001361010123318:15 AM14121800143201700194149600159203005326Total584832374571110540065154281500458717054151109Approach %10.284.64.01.2--16.90.083.10.0--3.393.43.30.0--46.76.746.70.0---Total %5.243.62.10.6-51.51.00.04.90.0-5.91.438.61.40.0-41.30.60.10.60.0-1.4-PHF0.6590.7230.6390.583-0.7890.5500.0000.7940.000-0.8550.6250.7180.6250.000-0.7200.5830.2500.5830.000-0.7500.838Motorcycles0000-00000-00000-00000-00% Motorcycles0.00.00.00.0-0.00.0-0.0--0.00.00.00.0--0.00.00.00.0--0.00.0Cars & Light Goods57470237-557110540-6515423150-4537170-151090% Cars & LightGoods98.397.3100.0100.0-97.5100.0-100.0--100.0100.098.8100.0--98.9100.0100.0100.0--100.098.3Buses11200-130000-00100-10000-014% Buses1.72.50.00.0-2.30.0-0.0--0.00.00.20.0--0.20.00.00.0--0.01.3Single-Unit Trucks0100-10000-00200-20000-03% Single-UnitTrucks0.00.20.00.0-0.20.0-0.0--0.00.00.50.0--0.40.00.00.0--0.00.3Articulated Trucks0000-00000-00200-20000-02% ArticulatedTrucks0.00.00.00.0-0.00.0-0.0--0.00.00.50.0--0.40.00.00.0--0.00.2Bicycles onCrosswalk----0-----0-----0-----1--% Bicycles onCrosswalk----0.0-----------------1.9--Pedestrians----4-----0-----0-----53--% Pedestrians----100.0-----------------98.1-- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ NE DWY -TUESSite Code:Start Date: 05/23/2023Page No: 6Peak Hour Data05/23/2023 7:30 AMEnding At05/23/2023 8:30 AMMotorcyclesCars & Light GoodsBusesSingle-Unit TrucksOtherKIMBALL AVE [N]OutInTotal0004915571048113142132024965711067000002347057700121000100000004234835874RTLUP74 0 0 1 73 0 Out 65 0 0 0 65 0 In 139 0 0 1 138 0 Total SCHOOL DWY [E] R 54 0 0 0 54 0 T 0 0 0 0 0 0 L 11 0 0 0 11 0 U 0 0 0 0 0 0 P 0 0 0 0 0 0 00048845394112113123022501458959OutInTotalKIMBALL AVE [S]ULTRP00000015423150001000020000200015428150NE DWY [W]Total05300053In01500015Out03800038000000U070007L010001T070007R00005454PTurning Movement Peak Hour Data Plot (7:30 AM) GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ NE DWY -TUESSite Code:Start Date: 05/23/2023Page No: 7Turning Movement Peak Hour Data (12:00 PM)Start TimeKIMBALL AVESCHOOL DWYKIMBALL AVENE DWYSouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total12:00 PM1080361201380090092813310016229115004535412:15 PM18144130139003003159011010741016005730612:30 PM69825901380070071411610013132022005433012:45 PM689271201340070071392100106360190055302Total233481324605490026002670431410506138172002111292Approach %4.263.424.08.4--0.00.0100.00.0--13.885.20.80.2--65.40.534.10.0---Total %1.826.910.23.6-42.50.00.02.00.0-2.05.433.40.30.1-39.210.70.15.60.0-16.3-PHF0.5750.8880.7500.885-0.9870.0000.0000.7220.000-0.7220.6250.8101.0000.250-0.7810.8410.2500.8180.000-0.9250.912Motorcycles0000-00000-00000-00000-00% Motorcycles0.00.00.00.0-0.0--0.0--0.00.00.00.00.0-0.00.00.00.0--0.00.0Cars & Light Goods2134513245-54300260-267042541-5001381720-2111280% Cars & LightGoods91.399.1100.097.8-98.9--100.0--100.0100.098.6100.0100.0-98.8100.0100.0100.0--100.099.1Buses2000-20000-00000-00000-02% Buses8.70.00.00.0-0.4--0.0--0.00.00.00.00.0-0.00.00.00.0--0.00.2Single-Unit Trucks0100-10000-00500-50000-06% Single-UnitTrucks0.00.30.00.0-0.2--0.0--0.00.01.20.00.0-1.00.00.00.0--0.00.5Articulated Trucks0201-30000-00100-10000-04% ArticulatedTrucks0.00.60.02.2-0.5--0.0--0.00.00.20.00.0-0.20.00.00.0--0.00.3Bicycles onCrosswalk----0-----0-----0-----0--% Bicycles onCrosswalk-------------------------Pedestrians----0-----0-----0-----0--% Pedestrians------------------------- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ NE DWY -TUESSite Code:Start Date: 05/23/2023Page No: 8Peak Hour Data05/23/2023 12:00 PMEnding At05/23/2023 1:00 PMMotorcyclesCars & Light GoodsBusesSingle-Unit TrucksOtherKIMBALL AVE [N]OutInTotal00063454311770225162356415491190000001323452145000200010000201013234823460RTLUP28 0 0 2 26 0 Out 26 0 0 0 26 0 In 54 0 0 2 52 0 Total SCHOOL DWY [E] R 26 0 0 0 26 0 T 0 0 0 0 0 0 L 0 0 0 0 0 0 U 0 0 0 0 0 0 P 0 0 0 0 0 0 000418500918000156213421506927OutInTotalKIMBALL AVE [S]ULTRP000001704254000000005000010017043140NE DWY [W]Total0413000413In0211000211Out0202000202000000U0138000138L010001T07200072R000000PTurning Movement Peak Hour Data Plot (12:00 PM) GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ VILLAGECENTER DR - 2ND STUDYSite Code:Start Date: 05/23/2023Page No: 1Turning Movement DataStart TimeKIMBALL AVEWESTBOUND STKIMBALL AVEVILLAGE CENTER DRSouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total7:00 AM0381104000000024100043000000837:15 AM0456105200000033000033000010857:30 AM05690065000000276000782000121457:45 AM011724101420000002782000109701205319270Hourly Total02564030299000000342290002639012055215838:00 AM0144303017700000034970001313406200964048:15 AM01151000125000000201110201334305300963548:30 AM07102073000000175000760000001498:45 AM0621306600000008100081000000147Hourly Total03924180441000000553640204217701150019210549:00 AM0000000000000000000000000*** BREAK ***-------------------------Hourly Total00000000000000000000000002:00 PM0106220110000000189010910020022032:15 PM07103074000000286010894020061692:30 PM0780308100000001070001072000021902:45 PM0732207700000029200094200002173Hourly Total03284100342000000537402038180400127353:00 PM07851084000000885000933030061833:15 PM0796108600000017870001042030051953:30 PM0107152012400000016960001122010032393:45 PM0120182014000000081190001275406000114381Hourly Total038444604340000004938700043661067001289984:00 PM085320900000002134000136200303232494:15 PM07501076000000310300010670700141964:30 PM0840108500000021150001175010062084:45 PM01121101140000001130000131201003248Hourly Total035645036500000084820004903401203469015:00 PM0941109600000031850001882020142885:15 PM0800308300000011330001342010032205:30 PM0810408500000031120001153010042045:45 PM072020740000001100000101101002177Hourly Total03271100338000000853000053880501138896:00 PM0000000000000000000000000Grand Total0204313442022190000001592366040252919702150594125160Approach %0.092.16.01.9--0.00.00.00.0--6.393.60.00.2--47.80.052.20.0---Total %0.039.62.60.8-43.00.00.00.00.0-0.03.145.90.00.1-49.03.80.04.20.0-8.0-Lights0198913442-21650000-0159231404-247719702140-4115053 % Lights-97.4100.0100.0-97.6------100.097.8-100.0-97.9100.0-99.5--99.897.9Mediums05300-530000-004700-470010-1101% Mediums-2.60.00.0-2.4------0.02.0-0.0-1.90.0-0.5--0.22.0Articulated Trucks0100-10000-00500-50000-06% ArticulatedTrucks-0.00.00.0-0.0------0.00.2-0.0-0.20.0-0.0--0.00.1Bicycles onCrosswalk----0-----0-----0-----2--% Bicycles onCrosswalk----------------------3.4--Pedestrians----0-----0-----0-----57--% Pedestrians----------------------96.6-- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ VILLAGECENTER DR - 2ND STUDYSite Code:Start Date: 05/23/2023Page No: 305/23/2023 7:00 AMEnding At05/23/2023 6:15 PMLightsMediumsArticulated TrucksBicycles on CrosswalkPedestriansKIMBALL AVE [N]OutInTotal25532165471847531005160000002605221948241341989042005300001000000000000013420430420RTLUP0 0 0 0 0 0 Out 0 0 0 0 0 0 In 0 0 0 0 0 0 Total WESTBOUND ST [E] R 0 0 0 0 0 0 T 0 0 0 0 0 0 L 0 0 0 0 0 0 U 0 0 0 0 0 0 P 0 0 0 0 0 0 2207247746845447101156000000226225294791OutInTotalKIMBALL AVE [S]ULTRP41592314000047000050000000000004159236600VILLAGE CENTER DR [W]Total7041000705In4111000412Out2930000293000000U1970000197L000000T2141000215R00025759PTurning Movement Data Plot GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ VILLAGECENTER DR - 2ND STUDYSite Code:Start Date: 05/23/2023Page No: 4Turning Movement Peak Hour Data (7:45 AM)Start TimeKIMBALL AVEWESTBOUND STKIMBALL AVEVILLAGE CENTER DRSouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total7:45 AM0117241014200000027820001097012053192708:00 AM0144303017700000034970001313406200964048:15 AM01151000125000000201110201334305300963548:30 AM0710207300000017500076000000149Total04476460517000000823650204498401270532111177Approach %0.086.512.41.2--0.00.00.00.0--18.381.30.00.4--39.80.060.20.0---Total %0.038.05.40.5-43.90.00.00.00.0-0.07.031.00.00.2-38.17.10.010.80.0-17.9-PHF0.0000.7760.5330.500-0.7300.0000.0000.0000.000-0.0000.6030.8220.0000.250-0.8440.4880.0000.5120.000-0.5490.728Lights0433646-5030000-08235802-4428401270-2111156% Lights-96.9100.0100.0-97.3------100.098.1-100.0-98.4100.0-100.0--100.098.2Mediums01400-140000-00600-60000-020% Mediums-3.10.00.0-2.7------0.01.6-0.0-1.30.0-0.0--0.01.7Articulated Trucks0000-00000-00100-10000-01% ArticulatedTrucks-0.00.00.0-0.0------0.00.3-0.0-0.20.0-0.0--0.00.1Bicycles onCrosswalk----0-----0-----0-----0--% Bicycles onCrosswalk----------------------0.0--Pedestrians----0-----0-----0-----53--% Pedestrians----------------------100.0-- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ VILLAGECENTER DR - 2ND STUDYSite Code:Start Date: 05/23/2023Page No: 5Peak Hour Data05/23/2023 7:45 AMEnding At05/23/2023 8:45 AMLightsMediumsArticulated TrucksBicycles on CrosswalkPedestriansKIMBALL AVE [N]OutInTotal448503951614201010000004555179726443306001400000000000000000064447060RTLUP0 0 0 0 0 0 Out 0 0 0 0 0 0 In 0 0 0 0 0 0 Total WESTBOUND ST [E] R 0 0 0 0 0 0 T 0 0 0 0 0 0 L 0 0 0 0 0 0 U 0 0 0 0 0 0 P 0 0 0 0 0 0 5624421004146200110000005764491025OutInTotalKIMBALL AVE [S]ULTRP282358000060000100000000000028236500VILLAGE CENTER DR [W]Total3570000357In2110000211Out1460000146000000U84000084L000000T1270000127R00005353PTurning Movement Peak Hour Data Plot (7:45 AM) GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ VILLAGECENTER DR - 2ND STUDYSite Code:Start Date: 05/23/2023Page No: 6Turning Movement Peak Hour Data (3:30 PM)Start TimeKIMBALL AVEWESTBOUND STKIMBALL AVEVILLAGE CENTER DRSouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total3:30 PM0107152012400000016960001122010032393:45 PM01201820140000000811900012754060001143814:00 PM085320900000002134000136200303232494:15 PM0750107600000031030001067070014196Total038736704300000002945200048183071031541065Approach %0.090.08.41.6--0.00.00.00.0--6.094.00.00.0--53.90.046.10.0---Total %0.036.33.40.7-40.40.00.00.00.0-0.02.742.40.00.0-45.27.80.06.70.0-14.5-PHF0.0000.8060.5000.875-0.7680.0000.0000.0000.000-0.0000.4530.8430.0000.000-0.8840.3840.0000.2960.000-0.3380.699Lights0375367-4180000-02944200-471830710-1541043% Lights-96.9100.0100.0-97.2------100.097.8---97.9100.0-100.0--100.097.9Mediums01200-120000-001000-100000-022% Mediums-3.10.00.0-2.8------0.02.2---2.10.0-0.0--0.02.1Articulated Trucks0000-00000-00000-00000-00% ArticulatedTrucks-0.00.00.0-0.0------0.00.0---0.00.0-0.0--0.00.0Bicycles onCrosswalk----0-----0-----0-----0--% Bicycles onCrosswalk----------------------0.0--Pedestrians----0-----0-----0-----3--% Pedestrians----------------------100.0-- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: KIMBALL AVE @ VILLAGECENTER DR - 2ND STUDYSite Code:Start Date: 05/23/2023Page No: 7Peak Hour Data05/23/2023 3:30 PMEnding At05/23/2023 4:30 PMLightsMediumsArticulated TrucksBicycles on CrosswalkPedestriansKIMBALL AVE [N]OutInTotal5324189501012220000000005424309723637507001200000000000000000036387070RTLUP0 0 0 0 0 0 Out 0 0 0 0 0 0 In 0 0 0 0 0 0 Total WESTBOUND ST [E] R 0 0 0 0 0 0 T 0 0 0 0 0 0 L 0 0 0 0 0 0 U 0 0 0 0 0 0 P 0 0 0 0 0 0 446471917121022000000000458481939OutInTotalKIMBALL AVE [S]ULTRP0294420000100000000000000000002945200VILLAGE CENTER DR [W]Total2190000219In1540000154Out65000065000000U83000083L000000T71000071R000033PTurning Movement Peak Hour Data Plot (3:30 PM) GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ RETAIL DWYSite Code:Start Date: 05/23/2023Page No: 1Turning Movement DataStart TimeRETAIL DWYFM 1709RETAIL DWYFM 1709SouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total7:00 AM000000019600019620100303760003765757:15 AM001001020120020310300424681104726807:30 AM002012523330024100101124722004767207:45 AM003003727810028610300444933600533826Hourly Total006016129086009264080112818093910185728018:00 AM1030048316500329105006448666005568958:15 AM30201593095003234090013248620205108518:30 AM206008928734030320500744869105008188:45 AM101100121031942033510500673421300362715Hourly Total7022012936123117601290802400321718001083019283279*** BREAK ***-------------------------2:00 PM30240027114541500480313900431531023003488982:15 PM31130017154071820442612500321133123003658562:30 PM30240027104902000520802800361129619003269092:45 PM201900211044611104683023002683532700388903Hourly Total11180009246179764301910202115001374512909200142735663:00 PM1026002720494900523913500451034224203789733:15 PM01131015154201510451402400281436125604069003:30 PM011500168427920446623000381037458204449443:45 PM012020231247615205051003101411037851504441013Hourly Total137430815518174850192529312001152441455158150167238304:00 PM231301189476161050262280036732728303659214:15 PM001801181246180048160220028733026303668934:30 PM109001010502120052461190026637220204009604:45 PM10160017145361010561532500331140418504381049Hourly Total4356026345197546202068236940012331143392130156938235:00 PM02170019155421000567402900334368293040410235:15 PM101260191355019005821139004112396302044010825:30 PM0019001918542500565602700331334223303819985:45 PM00111012193868004138125003433463010380839Hourly Total12597069652020420021271921200014132145211290160539426:00 PM0000000000000000000000000Grand Total249297104340259974822316010246103134810259717792396014101005821241Approach %7.12.687.42.9--2.595.12.20.2--17.32.280.60.0--1.891.96.00.4---Total %0.10.01.40.0-1.61.245.91.00.1-48.20.50.12.30.0-2.80.843.52.80.2-47.4-Lights23929710-339259965022115-10145103134740-590175910059740-991220986% Lights95.8100.0100.0100.0-99.7100.099.099.193.8-99.0100.0100.098.5--98.898.998.599.397.6-98.598.8Mediums1000-108020-820040-4211341-120207 % Mediums4.20.00.00.0-0.30.00.80.90.0-0.80.00.00.8--0.71.11.20.72.4-1.21.0Articulated Trucks0000-001801-190030-302600-2648% ArticulatedTrucks0.00.00.00.0-0.00.00.20.06.3-0.20.00.00.6--0.50.00.30.00.0-0.30.2Bicycles onCrosswalk----3-----0-----0-----0--% Bicycles onCrosswalk----75.0-----------0.0--------Pedestrians----1-----0-----2-----0--% Pedestrians----25.0-----------100.0-------- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ RETAIL DWYSite Code:Start Date: 05/23/2023Page No: 305/23/2023 7:00 AMEnding At05/23/2023 6:15 PMLightsMediumsArticulated TrucksBicycles on CrosswalkPedestriansRETAIL DWY [N]OutInTotal41933975841500000000042334076329792310000100000000000300001297924104RTLUP9760 0 0 30 118 9612 Out 10246 0 0 19 82 10145 In 20006 0 0 49 200 19757 Total FM 1709 [E] R 223 0 0 0 2 221 T 9748 0 0 18 80 9650 L 259 0 0 0 0 259 U 16 0 0 1 0 15 P 0 0 0 0 0 0 86559014554480330000008695971466OutInTotalRETAIL DWY [S]ULTRP0103134740000400003000000000020103134812FM 1709 [W]Total20002201440020247In9912120260010058Out100908118001018940100041U1752000177L910011326009239T5974000601R000000PTurning Movement Data Plot GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ RETAIL DWYSite Code:Start Date: 05/23/2023Page No: 4Turning Movement Peak Hour Data (7:45 AM)Start TimeRETAIL DWYFM 1709RETAIL DWYFM 1709SouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total7:45 AM0030037278100286103004449336005338268:00 AM1030048316500329105006448666005568958:15 AM30201593095003234090013248620205108518:30 AM20600892873403032050074486910500818Total6014012033119014401241802200301419511313020993390Approach %30.00.070.00.0--2.795.91.10.3--26.70.073.30.0--0.792.96.20.1---Total %0.20.00.40.0-0.61.035.10.40.1-36.60.20.00.60.0-0.90.457.63.90.1-61.9-PHF0.5000.0000.5830.000-0.6250.9170.9410.7000.250-0.9430.5000.0000.6110.000-0.5770.8750.9890.4960.375-0.9440.947Lights60140-20331172133-122180190-271319131283-20573325% Lights100.0-100.0--100.0100.098.592.975.0-98.4100.0-86.4--90.092.998.197.7100.0-98.098.1Mediums0000-001710-180020-213230-3656% Mediums0.0-0.0--0.00.01.47.10.0-1.50.0-9.1--6.77.11.62.30.0-1.71.7Articulated Trucks0000-00101-20010-10600-69% ArticulatedTrucks0.0-0.0--0.00.00.10.025.0-0.20.0-4.5--3.30.00.30.00.0-0.30.3Bicycles onCrosswalk----0-----0-----0-----0--% Bicycles onCrosswalk----0.0--------------------Pedestrians----1-----0-----0-----0--% Pedestrians----100.0-------------------- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ RETAIL DWYSite Code:Start Date: 05/23/2023Page No: 5Peak Hour Data05/23/2023 7:45 AMEnding At05/23/2023 8:45 AMLightsMediumsArticulated TrucksBicycles on CrosswalkPedestriansRETAIL DWY [N]OutInTotal26204620200000000028204814060000000000000000000001140601RTLUP1983 0 0 8 34 1941 Out 1241 0 0 2 18 1221 In 3224 0 0 10 52 3162 Total FM 1709 [E] R 14 0 0 0 1 13 T 1190 0 0 1 17 1172 L 33 0 0 0 0 33 U 4 0 0 1 0 3 P 0 0 0 0 0 0 1612718832501100000016430194OutInTotalRETAIL DWY [S]ULTRP08019000020000100000000000080220FM 1709 [W]Total3254537003314In2057366002099Out1197171001215300003U13100014L1913326001951T1283000131R000000PTurning Movement Peak Hour Data Plot (7:45 AM) GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ RETAIL DWYSite Code:Start Date: 05/23/2023Page No: 6Turning Movement Peak Hour Data (4:45 PM)Start TimeRETAIL DWYFM 1709RETAIL DWYFM 1709SouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total4:45 PM101600171453610105615325003311404185043810495:00 PM02170019155421000567402900334368293040410235:15 PM101260191355019005821139004112396302044010825:30 PM001900191854250056560270033133422330381998Total22646074602170441022751641200014040151010013016634152Approach %2.72.786.58.1--2.695.41.90.0--11.42.985.70.0--2.490.86.00.8---Total %0.00.01.50.1-1.81.452.31.10.0-54.80.40.12.90.0-3.41.036.42.40.3-40.1-PHF0.5000.2500.8420.250-0.9740.8330.9860.5790.250-0.9770.6670.3330.7690.000-0.8540.7690.9340.8330.650-0.9450.959Lights22646-74602159441-22641641200-14040149810012-16504128% Lights100.0100.0100.0100.0-100.0100.099.5100.0100.0-99.5100.0100.0100.0--100.0100.099.2100.092.3-99.299.4Mediums0000-00700-70000-00601-714% Mediums0.00.00.00.0-0.00.00.30.00.0-0.30.00.00.0--0.00.00.40.07.7-0.40.3Articulated Trucks0000-00400-40000-00600-610% ArticulatedTrucks0.00.00.00.0-0.00.00.20.00.0-0.20.00.00.0--0.00.00.40.00.0-0.40.2Bicycles onCrosswalk----0-----0-----0-----0--% Bicycles onCrosswalk-------------------------Pedestrians----0-----0-----0-----0--% Pedestrians------------------------- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: FM 1709 @ RETAIL DWYSite Code:Start Date: 05/23/2023Page No: 7Peak Hour Data05/23/2023 4:45 PMEnding At05/23/2023 5:45 PMLightsMediumsArticulated TrucksBicycles on CrosswalkPedestriansRETAIL DWY [N]OutInTotal9474168000000000000947416864226000000000000000000000642260RTLUP1633 0 0 6 6 1621 Out 2275 0 0 4 7 2264 In 3908 0 0 10 13 3885 Total FM 1709 [E] R 44 0 0 0 0 44 T 2170 0 0 4 7 2159 L 60 0 0 0 0 60 U 1 0 0 0 0 1 P 0 0 0 0 0 0 162140302000000000000162140302OutInTotalRETAIL DWY [S]ULTRP016412000000000000000000000001641200FM 1709 [W]Total39011510003926In165076001663Out22518400226312100013U40000040L149866001510T1000000100R000000PTurning Movement Peak Hour Data Plot (4:45 PM) GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: VILLAGE CENTER DR @ S DWY- TUESSite Code:Start Date: 05/23/2023Page No: 1Turning Movement DataStart TimeS DWYVILLAGE CENTER DRSCHOOL DWYVILLAGE CENTER DRSouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total12:00 AM000000000000000000000000012:15 AM000000000000000000000000012:30 AM000000000000000000000000012:45 AM0000000000000000000000000Hourly Total00000000000000000000000001:00 AM00000000000000000000000001:15 AM00000000000000000000000001:30 AM00000000000000000000000001:45 AM0000000000000000000001011Hourly Total00000000000000000000010112:00 AM00000000000000000000000002:15 AM00000000000000000000000002:30 AM00000000000000000000000002:45 AM0000000000000000000000000Hourly Total00000000000000000000000003:00 AM00000000000000000000000003:15 AM00000000000000000000000003:30 AM00000000000000000000000003:45 AM0000000000000000000000000Hourly Total00000000000000000000000004:00 AM00000000000000000000000004:15 AM00000000000000000000000004:30 AM00000000000000000000000004:45 AM0000000000000000000000000Hourly Total00000000000000000000000005:00 AM00000000000000000000000005:15 AM00100100000000000000000015:30 AM00000000000000000000000005:45 AM0000001000010000000000001Hourly Total00100110000100000000000026:00 AM00000000000000000000000006:15 AM00000010000100000000000016:30 AM00000000000000000000000006:45 AM0000000110020000000000002Hourly Total00000011100300000000000037:00 AM00000030000300000000000037:15 AM00000080000800000000100197:30 AM0000001110001200200200100115 7:45 AM000000510000513023002600240024101Hourly Total0000007310007430250028002600261288:00 AM000000560000562209600118016200632378:15 AM0000003100003180890097103000311598:30 AM00000001000100000000000018:45 AM0000000100010000000000001Hourly Total0000008720008930018500215119200943989:00 AM00000000200200100100000039:15 AM10000100000000100100000029:30 AM00000021200500000001000169:45 AM0000000010010010010000002Hourly Total1000012150080030030100011310:00 AM000000011002000000021003510:15 AM000000110002000000000000210:30 AM000000302005110002010001810:45 AM1000012120050020020100019Hourly Total10000163500141120040410052411:00 AM100001000000001001000000211:15 AM100001100001001001010001411:30 AM100001014005000000000000611:45 AM2000021110030000000100016Hourly Total5000052250090020020200021812:00 PM1000010510060000000300031012:15 PM100001001001000000000000212:30 PM100001131005001001020002912:45 PM0000000100010030030200026Hourly Total3000031930013004004070007271:00 PM00000011100300100114000591:15 PM00000001300400000003000371:30 PM200002221005005005040004161:45 PM1000010120030010010300038Hourly Total300003357001500700711400015402:00 PM00000021000300100101000152:15 PM20000210100200300301000182:30 PM10000100000000200200000032:45 PM0000002200040010010000005Hourly Total300003531009007007020002213:00 PM10000111110013003003023005223:15 PM00000018230023002002024006313:30 PM0000002134002800000003110014423:45 PM1906042519440027928900100159010315167Hourly Total200604266910120091929400105112270103402624:00 PM10000150000500190019021003284:15 PM10000121000300140114000000184:30 PM00000000200200600600000084:45 PM0000000110020030030000005Hourly Total200002723001200420142021003595:00 PM00000012100400300300000075:15 PM00000001000100000003000345:30 PM00000003000300000004000475:45 PM0000000010010000200200023Hourly Total00000016200900302309000921 6:00 PM10000102000200100101000156:15 PM00000001000100000001000126:30 PM10000102000200100104000486:45 PM1000010000000000000110023Hourly Total300003050005002002071008187:00 PM00000002000200000000000027:15 PM00000000100100100101000137:30 PM10000100000000000002000237:45 PM1000010010010000000300035Hourly Total200002022004001001060006138:00 PM10000100100100000001000138:15 PM10000101100200000000000038:30 PM10000100100100000000000028:45 PM0000000000000000000000000Hourly Total30000301300400000001000189:00 PM00000000000000000000000009:15 PM00000000000000000000000009:30 PM00000000000000000000000009:45 PM0000000000000000000000000Hourly Total000000000000000000000000010:00 PM000000000000000000010001110:15 PM000000000000000000000000010:30 PM000000000000000000000000010:45 PM0000000000000000000100011Hourly Total000000000000000000020002211:00 PM000000000000000000000000011:15 PM000000000000000000000000011:30 PM000000000000000000000000011:45 PM0000000000000000000000000Hourly Total0000000000000000000000000Grand Total460704532585349003604333770342337014811032221058Approach %86.80.013.20.0--71.714.713.60.0--10.20.789.10.0--1.431.566.70.5---Total %4.30.00.70.0-5.024.45.04.60.0-34.04.10.335.60.0-40.00.36.614.00.1-21.0-Motorcycles0000-00000-00000-00000-00% Motorcycles0.0-0.0--0.00.00.00.0--0.00.00.00.0--0.00.00.00.00.0-0.00.0Cars & Light Goods43070-5025753460-3564333760-4222671481-2181046% Cars & LightGoods93.5-100.0--94.399.6100.093.9--98.9100.0100.099.7--99.866.795.7100.0100.0-98.298.9Buses0000-00000-00000-00000-00% Buses0.0-0.0--0.00.00.00.0--0.00.00.00.0--0.00.00.00.00.0-0.00.0Single-Unit Trucks2000-21020-30010-11200-39% Single-UnitTrucks4.3-0.0--3.80.40.04.1--0.80.00.00.3--0.233.32.90.00.0-1.40.9Articulated Trucks1000-10010-10000-00100-13% ArticulatedTrucks2.2-0.0--1.90.00.02.0--0.30.00.00.0--0.00.01.40.00.0-0.50.3Bicycles onCrosswalk----0-----0-----1-----0--% Bicycles onCrosswalk----0.0-----------33.3-----0.0--Pedestrians----4-----0-----2-----103--% Pedestrians----100.0-----------66.7-----100.0-- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: VILLAGE CENTER DR @ S DWY- TUESSite Code:Start Date: 05/23/2023Page No: 405/23/2023 12:00 AMEnding At05/24/2023 12:00 AMMotorcyclesCars & Light GoodsBusesSingle-Unit TrucksOtherS DWY [SB]OutInTotal0005150101000325112555310800000704300000000020000104704604RTLUP493 2 5 0 486 0 Out 360 1 3 0 356 0 In 853 3 8 0 842 0 Total VILLAGE CENTER DR [WB R 49 1 2 0 46 0 T 53 0 0 0 53 0 L 258 0 1 0 257 0 U 0 0 0 0 0 0 P 0 0 0 0 0 0 000405422827000112000406423829OutInTotalSCHOOL DWY [NB]ULTRP000000433376000000000100000304333773VILLAGE CENTER DR [EB]Total0322031326In0218031222Out0104000104010001U020103L06702170T0148000148R0000103103PTurning Movement Data Plot GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: VILLAGE CENTER DR @ S DWY- TUESSite Code:Start Date: 05/23/2023Page No: 5Turning Movement Peak Hour Data (7:30 AM)Start TimeS DWYVILLAGE CENTER DRSCHOOL DWYVILLAGE CENTER DRSouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total7:30 AM00000011100012002002001001157:45 AM0000005100005130230026002400241018:00 AM000000560000562209600118016200632378:15 AM000000310000318089009710300031159Total0000001491000150330210002431111700119512Approach %0.00.00.00.0--99.30.70.00.0--13.60.086.40.0--0.80.898.30.0---Total %0.00.00.00.0-0.029.10.20.00.0-29.36.40.041.00.0-47.50.20.222.90.0-23.2-PHF0.0000.0000.0000.000-0.0000.6650.2500.0000.000-0.6700.3750.0000.5470.000-0.5150.2500.2500.4720.000-0.4720.540Motorcycles0000-00000-00000-00000-00% Motorcycles------0.00.0---0.00.0-0.0--0.00.00.00.0--0.00.0Cars & Light Goods0000-0149100-1503302100-243111170-119512% Cars & LightGoods------100.0100.0---100.0100.0-100.0--100.0100.0100.0100.0--100.0100.0Buses0000-00000-00000-00000-00% Buses------0.00.0---0.00.0-0.0--0.00.00.00.0--0.00.0Single-Unit Trucks0000-00000-00000-00000-00% Single-UnitTrucks------0.00.0---0.00.0-0.0--0.00.00.00.0--0.00.0Articulated Trucks0000-00000-00000-00000-00% ArticulatedTrucks------0.00.0---0.00.0-0.0--0.00.00.00.0--0.00.0Bicycles onCrosswalk----0-----0-----0-----0--% Bicycles onCrosswalk-------------------------Pedestrians----0-----0-----0-----0--% Pedestrians------------------------- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: VILLAGE CENTER DR @ S DWY- TUESSite Code:Start Date: 05/23/2023Page No: 6Peak Hour Data05/23/2023 7:30 AMEnding At05/23/2023 8:30 AMMotorcyclesCars & Light GoodsBusesSingle-Unit TrucksOtherS DWY [SB]OutInTotal000101000000000101000000000000000000000000000000RTLUP211 0 0 0 211 0 Out 150 0 0 0 150 0 In 361 0 0 0 361 0 Total VILLAGE CENTER DR [WB R 0 0 0 0 0 0 T 1 0 0 0 1 0 L 149 0 0 0 149 0 U 0 0 0 0 0 0 P 0 0 0 0 0 0 000266243509000000000266243509OutInTotalSCHOOL DWY [NB]ULTRP000000330210000000000000000003302100VILLAGE CENTER DR [EB]Total0153000153In0119000119Out03400034000000U010001L010001T0117000117R000000PTurning Movement Peak Hour Data Plot (7:30 AM) GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: VILLAGE CENTER DR @ S DWY- TUESSite Code:Start Date: 05/23/2023Page No: 7Turning Movement Peak Hour Data (3:15 PM)Start TimeS DWYVILLAGE CENTER DRSCHOOL DWYVILLAGE CENTER DRSouthboundWestboundNorthboundEastboundLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalLeftThruRightU-TurnPedsApp.TotalInt. Total3:15 PM00000018230023002002024006313:30 PM0000002134002800000003110014423:45 PM19060425194400279289001001590103151674:00 PM1000015000050019001902100328Total20060426639110083921100012111225010338268Approach %76.90.023.10.0--75.910.813.30.0--7.41.790.90.0--2.631.665.80.0---Total %7.50.02.20.0-9.723.53.44.10.0-31.03.40.741.00.0-45.10.44.59.30.0-14.2-PHF0.2630.0000.2500.000-0.2600.7500.5630.6880.000-0.7410.2500.2500.3090.000-0.3030.2500.6000.5680.000-0.6330.401Motorcycles0000-00000-00000-00000-00% Motorcycles0.0-0.0--0.00.00.00.0--0.00.00.00.0--0.00.00.00.0--0.00.0Cars & Light Goods20060-26639110-83921100-121112250-38268% Cars & LightGoods100.0-100.0--100.0100.0100.0100.0--100.0100.0100.0100.0--100.0100.0100.0100.0--100.0100.0Buses0000-00000-00000-00000-00% Buses0.0-0.0--0.00.00.00.0--0.00.00.00.0--0.00.00.00.0--0.00.0Single-Unit Trucks0000-00000-00000-00000-00% Single-UnitTrucks0.0-0.0--0.00.00.00.0--0.00.00.00.0--0.00.00.00.0--0.00.0Articulated Trucks0000-00000-00000-00000-00% ArticulatedTrucks0.0-0.0--0.00.00.00.0--0.00.00.00.0--0.00.00.00.0--0.00.0Bicycles onCrosswalk----0-----0-----0-----0--% Bicycles onCrosswalk----0.0-----------------0.0--Pedestrians----4-----0-----0-----103--% Pedestrians----100.0-----------------100.0-- GRAM Traffic NTX Inc.1120 W. Lovers LaneArlington, Texas, United States 76013817.265.8968Count Name: VILLAGE CENTER DR @ S DWY- TUESSite Code:Start Date: 05/23/2023Page No: 8Peak Hour Data05/23/2023 3:15 PMEnding At05/23/2023 4:15 PMMotorcyclesCars & Light GoodsBusesSingle-Unit TrucksOtherS DWY [SB]OutInTotal00014264000000000014264000000602000000000000000004602004RTLUP142 0 0 0 142 0 Out 83 0 0 0 83 0 In 225 0 0 0 225 0 Total VILLAGE CENTER DR [WB R 11 0 0 0 11 0 T 9 0 0 0 9 0 L 63 0 0 0 63 0 U 0 0 0 0 0 0 P 0 0 0 0 0 0 0008812120900000000088121209OutInTotalSCHOOL DWY [NB]ULTRP0000009211000000000000000000921100VILLAGE CENTER DR [EB]Total06200062In03800038Out02400024000000U010001L01200012T02500025R0000103103PTurning Movement Peak Hour Data Plot (3:15 PM) Channel NE DWY NE DWY Direction Eastbound Westbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 1 1 2 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 1 1 9:00 AM 0 0 0 9:15 AM 1 1 2 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 1 1 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 1 1 12:00 PM 1 1 2 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - MON - EB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 0 1 1 12:30 PM 1 0 1 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 2 0 2 1:30 PM 0 0 0 1:45 PM 0 1 1 2:00 PM 1 0 1 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 1 0 1 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 8 8 16 Channel KIMBALL AVE KIMBALL AVE Direction Northbound Southbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 1 1 2:45 AM 1 0 1 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 1 1 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 1 0 1 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 1 0 1 6:30 AM 9 0 9 6:45 AM 14 1 15 7:00 AM 2 1 3 7:15 AM 0 0 0 7:30 AM 1 2 3 7:45 AM 0 2 2 8:00 AM 2 5 7 8:15 AM 2 6 8 8:30 AM 5 1 6 8:45 AM 10 1 11 9:00 AM 3 1 4 9:15 AM 1 1 2 9:30 AM 2 1 3 9:45 AM 1 3 4 10:00 AM 0 2 2 10:15 AM 3 1 4 10:30 AM 2 1 3 10:45 AM 1 1 2 11:00 AM 4 0 4 11:15 AM 3 1 4 11:30 AM 1 4 5 11:45 AM 1 1 2 12:00 PM 1 0 1 Site Code Study Name KIMBALL AVE @ NE DWY - MON - NB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 3 2 5 12:30 PM 1 2 3 12:45 PM 1 2 3 1:00 PM 1 1 2 1:15 PM 2 1 3 1:30 PM 0 0 0 1:45 PM 0 1 1 2:00 PM 4 4 8 2:15 PM 5 3 8 2:30 PM 3 2 5 2:45 PM 7 0 7 3:00 PM 0 3 3 3:15 PM 1 5 6 3:30 PM 1 4 5 3:45 PM 7 1 8 4:00 PM 1 1 2 4:15 PM 1 2 3 4:30 PM 1 5 6 4:45 PM 0 1 1 5:00 PM 2 2 4 5:15 PM 0 0 0 5:30 PM 0 1 1 5:45 PM 1 0 1 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 1 1 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 1 1 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 113 83 196 Channel KIMBALL AVE KIMBALL AVE Direction Southbound Northbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 1 0 1 2:45 AM 0 1 1 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 1 0 1 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 1 1 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 1 0 1 6:15 AM 0 1 1 6:30 AM 0 10 10 6:45 AM 1 14 15 7:00 AM 1 2 3 7:15 AM 0 0 0 7:30 AM 3 2 5 7:45 AM 3 0 3 8:00 AM 5 2 7 8:15 AM 6 2 8 8:30 AM 1 5 6 8:45 AM 2 10 12 9:00 AM 1 3 4 9:15 AM 2 2 4 9:30 AM 1 2 3 9:45 AM 3 1 4 10:00 AM 3 0 3 10:15 AM 1 5 6 10:30 AM 1 2 3 10:45 AM 1 1 2 11:00 AM 0 4 4 11:15 AM 1 3 4 11:30 AM 5 2 7 11:45 AM 2 1 3 12:00 PM 2 1 3 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - MON - SB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 2 2 4 12:30 PM 2 2 4 12:45 PM 2 1 3 1:00 PM 1 1 2 1:15 PM 0 3 3 1:30 PM 1 0 1 1:45 PM 2 1 3 2:00 PM 4 5 9 2:15 PM 3 6 9 2:30 PM 1 4 5 2:45 PM 0 7 7 3:00 PM 6 0 6 3:15 PM 5 1 6 3:30 PM 4 1 5 3:45 PM 1 7 8 4:00 PM 1 1 2 4:15 PM 2 1 3 4:30 PM 5 1 6 4:45 PM 1 0 1 5:00 PM 2 2 4 5:15 PM 0 0 0 5:30 PM 1 0 1 5:45 PM 0 2 2 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 1 0 1 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 1 0 1 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 96 125 221 Channel SCHOOL DWY SCHOOL DWY Direction Westbound Eastbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 1 1 6:15 AM 0 0 0 6:30 AM 1 0 1 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 1 1 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 1 1 2 10:00 AM 0 0 0 10:15 AM 2 0 2 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 1 1 2 11:45 AM 0 0 0 12:00 PM 0 2 2 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - MON - WB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 1 1 2 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 0 0 0 1:30 PM 0 1 1 1:45 PM 1 0 1 2:00 PM 0 0 0 2:15 PM 1 0 1 2:30 PM 2 0 2 2:45 PM 0 0 0 3:00 PM 0 3 3 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 10 11 21 Channel NE DWY NE DWY Direction Eastbound Westbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 1 0 1 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 1 1 10:15 AM 1 0 1 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 1 1 11:15 AM 1 0 1 11:30 AM 2 1 3 11:45 AM 1 0 1 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - TUES - EB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 0 0 0 1:30 PM 0 1 1 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 1 1 3:00 PM 1 0 1 3:15 PM 0 0 0 3:30 PM 1 0 1 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 1 1 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 8 6 14 Channel KIMBALL AVE KIMBALL AVE Direction Northbound Southbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 1 1 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 1 1 5:15 AM 1 0 1 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 10 0 10 6:45 AM 11 0 11 7:00 AM 5 1 6 7:15 AM 0 1 1 7:30 AM 0 1 1 7:45 AM 0 2 2 8:00 AM 3 6 9 8:15 AM 2 4 6 8:30 AM 2 2 4 8:45 AM 1 1 2 9:00 AM 5 0 5 9:15 AM 4 2 6 9:30 AM 0 2 2 9:45 AM 1 4 5 10:00 AM 1 0 1 10:15 AM 3 1 4 10:30 AM 2 1 3 10:45 AM 2 0 2 11:00 AM 3 1 4 11:15 AM 2 0 2 11:30 AM 1 4 5 11:45 AM 0 0 0 12:00 PM 1 2 3 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - TUES - NB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 1 0 1 12:30 PM 3 1 4 12:45 PM 1 0 1 1:00 PM 3 1 4 1:15 PM 3 1 4 1:30 PM 1 0 1 1:45 PM 0 1 1 2:00 PM 3 5 8 2:15 PM 2 0 2 2:30 PM 9 2 11 2:45 PM 4 0 4 3:00 PM 0 0 0 3:15 PM 1 4 5 3:30 PM 1 5 6 3:45 PM 9 3 12 4:00 PM 1 2 3 4:15 PM 1 3 4 4:30 PM 0 5 5 4:45 PM 4 1 5 5:00 PM 0 1 1 5:15 PM 2 1 3 5:30 PM 0 4 4 5:45 PM 3 0 3 6:00 PM 1 1 2 6:15 PM 0 2 2 6:30 PM 0 0 0 6:45 PM 1 1 2 7:00 PM 0 0 0 7:15 PM 1 0 1 7:30 PM 0 0 0 7:45 PM 0 1 1 8:00 PM 0 0 0 8:15 PM 1 0 1 8:30 PM 1 0 1 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 117 82 199 Channel KIMBALL AVE KIMBALL AVE Direction Southbound Northbound TOTAL 12:00 AM 1 1 2 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 1 1 2 5:00 AM 2 1 3 5:15 AM 0 1 1 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 10 10 6:45 AM 0 11 11 7:00 AM 1 5 6 7:15 AM 1 0 1 7:30 AM 1 0 1 7:45 AM 3 0 3 8:00 AM 6 3 9 8:15 AM 4 2 6 8:30 AM 2 2 4 8:45 AM 1 1 2 9:00 AM 0 5 5 9:15 AM 2 4 6 9:30 AM 2 0 2 9:45 AM 4 1 5 10:00 AM 1 1 2 10:15 AM 0 5 5 10:30 AM 1 2 3 10:45 AM 0 2 2 11:00 AM 2 3 5 11:15 AM 0 3 3 11:30 AM 3 1 4 11:45 AM 0 1 1 12:00 PM 4 1 5 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - TUES - SB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 1 2 3 12:30 PM 1 3 4 12:45 PM 0 1 1 1:00 PM 1 3 4 1:15 PM 1 3 4 1:30 PM 0 0 0 1:45 PM 1 0 1 2:00 PM 5 3 8 2:15 PM 0 2 2 2:30 PM 1 10 11 2:45 PM 0 3 3 3:00 PM 3 1 4 3:15 PM 4 1 5 3:30 PM 4 1 5 3:45 PM 3 9 12 4:00 PM 2 1 3 4:15 PM 3 1 4 4:30 PM 5 0 5 4:45 PM 0 3 3 5:00 PM 1 0 1 5:15 PM 1 2 3 5:30 PM 4 0 4 5:45 PM 0 3 3 6:00 PM 1 1 2 6:15 PM 2 0 2 6:30 PM 0 0 0 6:45 PM 1 1 2 7:00 PM 0 0 0 7:15 PM 0 1 1 7:30 PM 0 0 0 7:45 PM 1 0 1 8:00 PM 0 0 0 8:15 PM 0 1 1 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 88 123 211 Channel SCHOOL DWY SCHOOL DWY Direction Westbound Eastbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 1 1 2 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 1 1 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 2 0 2 10:30 AM 1 1 2 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 2 2 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - TUES - WB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 2 0 2 2:45 PM 0 0 0 3:00 PM 0 3 3 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 1 1 2 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 7 9 16 Channel NE DWY NE DWY Direction Eastbound Westbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 1 1 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 1 0 1 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 1 1 2 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 1 1 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - WED - EB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 1 1 1:00 PM 1 1 2 1:15 PM 1 0 1 1:30 PM 0 0 0 1:45 PM 0 1 1 2:00 PM 0 0 0 2:15 PM 1 0 1 2:30 PM 1 0 1 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 1 0 1 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 1 1 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 7 7 14 Channel KIMBALL AVE KIMBALL AVE Direction Northbound Southbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 1 1 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 1 1 2 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 10 0 10 6:45 AM 15 0 15 7:00 AM 2 0 2 7:15 AM 0 1 1 7:30 AM 2 3 5 7:45 AM 3 3 6 8:00 AM 2 3 5 8:15 AM 2 6 8 8:30 AM 1 0 1 8:45 AM 0 1 1 9:00 AM 0 2 2 9:15 AM 0 3 3 9:30 AM 2 1 3 9:45 AM 5 1 6 10:00 AM 2 0 2 10:15 AM 1 3 4 10:30 AM 1 6 7 10:45 AM 5 1 6 11:00 AM 4 2 6 11:15 AM 4 1 5 11:30 AM 3 1 4 11:45 AM 1 2 3 12:00 PM 10 3 13 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - WED - NB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 6 1 7 12:30 PM 2 1 3 12:45 PM 8 2 10 1:00 PM 1 1 2 1:15 PM 1 7 8 1:30 PM 2 5 7 1:45 PM 1 0 1 2:00 PM 1 0 1 2:15 PM 8 2 10 2:30 PM 3 2 5 2:45 PM 1 0 1 3:00 PM 4 1 5 3:15 PM 2 6 8 3:30 PM 2 3 5 3:45 PM 1 5 6 4:00 PM 1 2 3 4:15 PM 0 0 0 4:30 PM 2 1 3 4:45 PM 1 1 2 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 1 0 1 5:45 PM 1 0 1 6:00 PM 0 0 0 6:15 PM 0 2 2 6:30 PM 1 0 1 6:45 PM 1 0 1 7:00 PM 0 1 1 7:15 PM 1 3 4 7:30 PM 0 1 1 7:45 PM 0 0 0 8:00 PM 1 0 1 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 1 0 1 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 130 92 222 Channel KIMBALL AVE KIMBALL AVE Direction Southbound Northbound TOTAL 12:00 AM 0 0 0 12:15 AM 1 0 1 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 1 1 2 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 10 10 6:45 AM 1 15 16 7:00 AM 0 2 2 7:15 AM 1 0 1 7:30 AM 4 3 7 7:45 AM 4 4 8 8:00 AM 3 2 5 8:15 AM 6 2 8 8:30 AM 0 0 0 8:45 AM 1 1 2 9:00 AM 2 0 2 9:15 AM 4 1 5 9:30 AM 1 2 3 9:45 AM 1 5 6 10:00 AM 0 2 2 10:15 AM 3 1 4 10:30 AM 6 1 7 10:45 AM 1 5 6 11:00 AM 2 3 5 11:15 AM 1 4 5 11:30 AM 1 3 4 11:45 AM 2 1 3 12:00 PM 3 10 13 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - WED - SB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 1 6 7 12:30 PM 1 2 3 12:45 PM 3 8 11 1:00 PM 2 2 4 1:15 PM 7 2 9 1:30 PM 5 2 7 1:45 PM 1 1 2 2:00 PM 0 1 1 2:15 PM 2 9 11 2:30 PM 1 6 7 2:45 PM 0 1 1 3:00 PM 4 4 8 3:15 PM 5 2 7 3:30 PM 3 2 5 3:45 PM 5 1 6 4:00 PM 2 1 3 4:15 PM 0 0 0 4:30 PM 1 2 3 4:45 PM 1 1 2 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 1 1 2 5:45 PM 0 1 1 6:00 PM 0 0 0 6:15 PM 2 0 2 6:30 PM 0 1 1 6:45 PM 0 1 1 7:00 PM 1 0 1 7:15 PM 3 1 4 7:30 PM 1 0 1 7:45 PM 0 0 0 8:00 PM 0 1 1 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 1 1 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 101 138 239 Channel SCHOOL DWY SCHOOL DWY Direction Westbound Eastbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 1 1 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 1 1 8:45 AM 1 0 1 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name KIMBALL AVE @ NE DWY - WED - WB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 3 0 3 2:45 PM 0 0 0 3:00 PM 0 3 3 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 4 5 9 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Eastbound Westbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 1 1 2 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - MON - EB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 1 1 2 Channel SCHOOL DWY SCHOOL DWY Direction Northbound Southbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - MON - NB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 1 1 1:00 PM 1 0 1 1:15 PM 0 0 0 1:30 PM 0 1 1 1:45 PM 0 0 0 2:00 PM 1 0 1 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 2 2 4 Channel S DWY S DWY Direction Southbound Northbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 1 1 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 1 0 1 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 2 1 3 12:00 PM 1 0 1 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - MON - SB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 1 0 1 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 1 1 2 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 6 3 9 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Westbound Eastbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 1 0 1 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 1 1 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 1 2 3 12:00 PM 0 1 1 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - MON - WB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 1 1 12:45 PM 1 0 1 1:00 PM 0 1 1 1:15 PM 0 0 0 1:30 PM 1 0 1 1:45 PM 0 0 0 2:00 PM 0 1 1 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 1 1 2 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 5 8 13 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Eastbound Westbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - TUES - EB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 1 0 1 1:15 PM 1 0 1 1:30 PM 1 0 1 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 1 0 1 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 4 0 4 Channel SCHOOL DWY SCHOOL DWY Direction Northbound Southbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 1 1 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - TUES - NB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 1 0 1 1:00 PM 0 0 0 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 1 1 2 Channel S DWY S DWY Direction Southbound Northbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 1 1 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 1 0 1 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - TUES - SB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 1 1 2 12:45 PM 0 0 0 1:00 PM 0 1 1 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 1 0 1 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 1 1 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 3 4 7 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Westbound Eastbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 1 0 1 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 1 0 1 10:45 AM 0 0 0 11:00 AM 0 1 1 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - TUES - WB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 1 1 2 12:45 PM 0 1 1 1:00 PM 0 0 0 1:15 PM 0 1 1 1:30 PM 0 1 1 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 1 1 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 1 0 1 8:00 PM 0 1 1 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 4 7 11 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Eastbound Westbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 1 0 1 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 1 0 1 9:45 AM 0 0 0 10:00 AM 1 0 1 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - WED - EB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 1 0 1 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 1 0 1 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 5 0 5 Channel SCHOOL DWY SCHOOL DWY Direction Northbound Southbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 1 1 7:30 AM 1 0 1 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 1 1 9:30 AM 0 1 1 9:45 AM 1 0 1 10:00 AM 0 0 0 10:15 AM 1 0 1 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - WED - NB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 1 1 2 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 4 4 8 Channel S DWY S DWY Direction Southbound Northbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 1 1 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 1 1 2 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 1 1 10:45 AM 0 0 0 11:00 AM 1 0 1 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 1 1 12:00 PM 1 0 1 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - WED - SB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 0 1 1 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 2 1 3 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 5 6 11 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Westbound Eastbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 1 1 2 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 1 0 1 7:30 AM 0 1 1 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 1 0 1 9:30 AM 2 2 4 9:45 AM 0 1 1 10:00 AM 0 1 1 10:15 AM 0 1 1 10:30 AM 1 0 1 10:45 AM 0 0 0 11:00 AM 0 1 1 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 1 0 1 12:00 PM 0 1 1 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ S DWY - WED - WB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 1 1 1:15 PM 1 0 1 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 2 2 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 8 12 20 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Northbound Southbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ W DWY - MON - NB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 0 0 0 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Southbound Northbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 1 1 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ W DWY - MON - SB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 1 0 1 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 1 1 2 Channel W DWY W DWY Direction Westbound Eastbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 1 0 1 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ W DWY - MON - WB APPROACH Start Date 05/22/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 1 1 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 1 1 2 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Northbound Southbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ W DWY - TUES - NB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 1 1 1:15 PM 0 1 1 1:30 PM 0 1 1 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 1 1 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 0 4 4 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Southbound Northbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 0 1 1 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ W DWY - TUES - SB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 1 0 1 1:15 PM 0 0 0 1:30 PM 1 0 1 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 2 1 3 Channel W DWY W DWY Direction Westbound Eastbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 1 0 1 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ W DWY - TUES - WB APPROACH Start Date 05/23/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 1 0 1 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 1 0 1 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 3 0 3 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Northbound Southbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 1 1 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 1 1 9:45 AM 0 0 0 10:00 AM 0 1 1 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 0 0 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ W DWY - WED - NB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 1 1 1:15 PM 0 0 0 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 1 1 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 0 5 5 Channel VILLAGE CENTER DR VILLAGE CENTER DR Direction Southbound Northbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 0 0 0 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 0 0 0 9:45 AM 0 0 0 10:00 AM 1 0 1 10:15 AM 0 0 0 10:30 AM 0 0 0 10:45 AM 0 0 0 11:00 AM 0 1 1 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ W DWY - WED - SB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 1 0 1 1:15 PM 0 1 1 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 1 0 1 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 3 2 5 Channel W DWY W DWY Direction Westbound Eastbound TOTAL 12:00 AM 0 0 0 12:15 AM 0 0 0 12:30 AM 0 0 0 12:45 AM 0 0 0 1:00 AM 0 0 0 1:15 AM 0 0 0 1:30 AM 0 0 0 1:45 AM 0 0 0 2:00 AM 0 0 0 2:15 AM 0 0 0 2:30 AM 0 0 0 2:45 AM 0 0 0 3:00 AM 0 0 0 3:15 AM 0 0 0 3:30 AM 0 0 0 3:45 AM 0 0 0 4:00 AM 0 0 0 4:15 AM 0 0 0 4:30 AM 0 0 0 4:45 AM 0 0 0 5:00 AM 0 0 0 5:15 AM 0 0 0 5:30 AM 1 0 1 5:45 AM 0 0 0 6:00 AM 0 0 0 6:15 AM 0 0 0 6:30 AM 0 0 0 6:45 AM 0 0 0 7:00 AM 0 0 0 7:15 AM 0 0 0 7:30 AM 0 0 0 7:45 AM 0 0 0 8:00 AM 0 0 0 8:15 AM 0 0 0 8:30 AM 0 0 0 8:45 AM 0 0 0 9:00 AM 0 0 0 9:15 AM 0 0 0 9:30 AM 2 0 2 9:45 AM 0 0 0 10:00 AM 0 0 0 10:15 AM 0 0 0 10:30 AM 1 1 2 10:45 AM 0 0 0 11:00 AM 1 0 1 11:15 AM 0 0 0 11:30 AM 0 0 0 11:45 AM 0 0 0 12:00 PM 0 0 0 Site Code Trucks and Buses Study Name VILLAGE CENTER DR @ W DWY - WED - WB APPROACH Start Date 05/24/2023 Start Time 12:00 AM 12:15 PM 0 0 0 12:30 PM 0 0 0 12:45 PM 0 0 0 1:00 PM 0 0 0 1:15 PM 1 0 1 1:30 PM 0 0 0 1:45 PM 0 0 0 2:00 PM 0 0 0 2:15 PM 0 0 0 2:30 PM 0 0 0 2:45 PM 0 0 0 3:00 PM 0 0 0 3:15 PM 0 0 0 3:30 PM 0 0 0 3:45 PM 0 0 0 4:00 PM 0 0 0 4:15 PM 0 0 0 4:30 PM 0 0 0 4:45 PM 0 0 0 5:00 PM 0 0 0 5:15 PM 0 0 0 5:30 PM 0 0 0 5:45 PM 0 0 0 6:00 PM 0 0 0 6:15 PM 0 0 0 6:30 PM 0 0 0 6:45 PM 0 0 0 7:00 PM 0 0 0 7:15 PM 0 0 0 7:30 PM 0 0 0 7:45 PM 0 0 0 8:00 PM 0 0 0 8:15 PM 0 0 0 8:30 PM 0 0 0 8:45 PM 0 0 0 9:00 PM 0 0 0 9:15 PM 0 0 0 9:30 PM 0 0 0 9:45 PM 0 0 0 10:00 PM 0 0 0 10:15 PM 0 0 0 10:30 PM 0 0 0 10:45 PM 0 0 0 11:00 PM 0 0 0 11:15 PM 0 0 0 11:30 PM 0 0 0 11:45 PM 0 0 0 6 1 7 Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - C - Appendix C – Turning Movement Traffic Volume Exhibits DEVELOPMENT SITE FLOOR & DECOR RETAILRD RETNEC EGALLIVRD DOOWTSEWRD DOOWTSAEEVA LLABMIK .SNL DEKOOR CRD NOCI LISRD NELON .SEVA LLABMIK .NNL YDAHSNL YRREHCRD RETNEC EGALLIV )DVLB EKALHTUOS( 9071 MF Sheet Number Sheet Title Checked By: Drawn By: Project No.: Issued: Scale: 7/26/2023MURILLO-4154RCH...\HALFF_CLR_PENTABLE.TBLPDF_2D_CLR_FW_MR_300.pltSheetA:\54000s\54063\001\TRANS\500 CADD\Sheets\TR-EXH-FIG3-54063.dgnHALFFah317910:53:22 AM7/26/2023CM SM 1" = 400' 54063(214) 346-6200RICHARDSON, TX 75081-22751201 NORTH BOWSER ROADFLOOR & DECORRETAIL DEVELOPMENTSOUTHLAKE, TEXASN 0 200 400 600 800 SCALE: 1"=400' LEGEND FIGURE 3 STUDY INTERSECTIONS EXISTING AND PROPOSED CONTROL INTERSECTION EXISTING TWO-WAY STOP CONTROL INTERSECTION EXISTING SIGNALIZED DEVELOPMENT SITE FLOOR & DECOR RETAIL 1 5 2 34RD RETNEC EGALLIVRD DOOWTSEWRD DOOWTSAEEVA LLABMIK .SNL DEKOOR CRD NOCI LISRD NELON .SEVA LLABMIK .NNL YDAHSNL YRREHCRD RETNEC EGALLIV )DVLB EKALHTUOS( 9071 MF Sheet Number Sheet Title Checked By: Drawn By: Project No.: Issued: Scale: 7/26/2023MURILLO-4154RCH...\HALFF_CLR_PENTABLE.TBLPDF_2D_CLR_FW_MR_300.pltSheetA:\54000s\54063\001\TRANS\500 CADD\Sheets\TR-EXH-FIG4-54063.dgnHALFFah317910:53:24 AM7/26/2023CM SM 1" = 400' 54063(214) 346-6200RICHARDSON, TX 75081-22751201 NORTH BOWSER ROADFLOOR & DECORRETAIL DEVELOPMENTSOUTHLAKE, TEXASN 0 200 400 600 800 SCALE: 1"=400' LEGEND X FIGURE 4 TRAFFIC CONTROLS LANE ASSIGNMENTS AND EXISTING AND PROPOSED INTERSECTION NODE NUMBER CONFIGURATION EXISTING LANE CONTROL APPROACH EXISTING STOP DEVELOPMENT SITE FLOOR & DECOR RETAIL 1 5 2 34RD RETNEC EGALLIVRD DOOWTSEWRD DOOWTSAEEVA LLABMIK .SNL DEKOOR CRD NOCI LISRD NELON .SEVA LLABMIK .NNL YDAHSNL YRREHCRD RETNEC EGALLIV )DVLB EKALHTUOS( 9071 MF X Sheet Number Sheet Title Checked By: Drawn By: Project No.: Issued: Scale: 7/26/2023MURILLO-4154RCH...\HALFF_CLR_PENTABLE.TBLPDF_2D_CLR_FW_MR_300.pltSheetA:\54000s\54063\001\TRANS\500 CADD\Sheets\TR-EXH-FIG5-54063.dgnHALFFah317910:53:25 AM7/26/2023CM SM 1" = 400' 54063(214) 346-6200RICHARDSON, TX 75081-22751201 NORTH BOWSER ROADFLOOR & DECORRETAIL DEVELOPMENTSOUTHLAKE, TEXASN 44 15 14 3 2930822004 33 14 5 55 48006143317426264 1 60 44 164040 13 1 27 12 0 1 1 0 9942033001 0 0 10 0 69 120000002060000 7 0 1 2 06000 0 7 0 61 67 0 84 0 4908226444209 5 0 59 0 0 5 7 0 0 4080171300 0 10 49 0 0 3 2611442923224886 0 0 16 56 4816383 43 0 0 9 2 07117 73 2 95120 3 26 0 200 400 600 800 SCALE: 1"=400'190279573190265476211 1,510 252 428491669365447127 208138 116 1,190 1,951 131 2341,183 252142245466 238 1,185 179 405377109108 3843871201,817 1,455 158 253381100116 1,493 297157226528 270 1,393 102 524133183671202,170 1,510 100 109 230988560LEGEND FIGURE 5 APPROACH MOVEMENTS INTERSECTION NODE NUMBER VOLUMES 2023 EXISTINGXXXXXXXXXXXXHOUR VOLUMES SCHOOL PM PEAK HOUR VOLUMES COMMUTER PM PEAK HOUR VOLUMES AM PEAK DEVELOPMENT SITE FLOOR & DECOR RETAIL 1 5 2 34RD RETNEC EGALLIVRD DOOWTSEWRD DOOWTSAEEVA LLABMIK .SNL DEKOOR CRD NOCI LISRD NELON .SEVA LLABMIK .NNL YDAHSNL YRREHCRD RETNEC EGALLIV )DVLB EKALHTUOS( 9071 MF X Sheet Number Sheet Title Checked By: Drawn By: Project No.: Issued: Scale: 7/26/2023MURILLO-4154RCH...\HALFF_CLR_PENTABLE.TBLPDF_2D_CLR_FW_MR_300.pltSheetA:\54000s\54063\001\TRANS\500 CADD\Sheets\TR-EXH-FIG6-54063.dgnHALFFah317910:53:27 AM7/26/2023CM SM 1" = 400' 54063(214) 346-6200RICHARDSON, TX 75081-22751201 NORTH BOWSER ROADFLOOR & DECORRETAIL DEVELOPMENTSOUTHLAKE, TEXASN 45 15 14 3 3030822004 34 14 5 56 49006143317526265 1 61 45 164041 13 1 12 0 1 1 0 9962034001 0 0 10 0 70 120000002060000 7 0 1 2 06000 0 7 0 62 68 0 0 50084265452809 5 0 60 0 0 5 7 0 0 410171300 0 10 50 0 0 3 271145302322134988 0 0 16 57 4916385 44 0 0 9 2 07217 74 2120 3 26 0 200 400 600 800 SCALE: 1"=400'194285584 111194270486 215 1,540 257 43750166937245686 130 1,214 1,990 134 212141 118 2352391001,207 257 97145250475243 1,209 183 4138385111110 39539228122 1,853 1,484 161 258389102118 1,523 303160231539 275 1,421 104 5343245713741222,213 1,540 102 LEGEND VOLUMES 2024 NO BUILD FIGURE 6XXXXXXXXXXXXAPPROACH MOVEMENTS INTERSECTION NODE NUMBER HOUR VOLUMES SCHOOL PM PEAK HOUR VOLUMES COMMUTER PM PEAK HOUR VOLUMES AM PEAK DEVELOPMENT SITE FLOOR & DECOR RETAIL 1 5 2 34RD RETNEC EGALLIVRD DOOWTSEWRD DOOWTSAEEVA LLABMIK .SNL DEKOOR CRD NOCI LISRD NELON .SEVA LLABMIK .NNL YDAHSNL YRREHCRD RETNEC EGALLIV )DVLB EKALHTUOS( 9071 MF X Sheet Number Sheet Title Checked By: Drawn By: Project No.: Issued: Scale: 7/26/2023MURILLO-4154RCH...\HALFF_CLR_PENTABLE.TBLPDF_2D_CLR_FW_MR_300.pltSheetA:\54000s\54063\001\TRANS\500 CADD\Sheets\TR-EXH-FIG7-54063.dgnHALFFah317910:53:29 AM7/26/2023CM SM 1" = 400' 54063(214) 346-6200RICHARDSON, TX 75081-22751201 NORTH BOWSER ROADFLOOR & DECORRETAIL DEVELOPMENTSOUTHLAKE, TEXASN 3 1650 17 1670083335 37 16 54 6 30332590062172272 50 1 68 501845 15 0 1 30 1 0 00007000 1 0 14 11 0 20103701 078230000 2 8 0 1 70000 8 0 0 0 95 75 69 0 7250055922206 10 0 0 6 866 0 0 3350120 11 0 55 29 0 0 9045151900 325971554 63 0 0 18 1835448 0 93 0 210 128 82 2 080103 27 0 200 400 600 800 SCALE: 1"=400'7710214314645 123214298536 238 1,701 284 482553411503143 234155 131 1,340 2,197 148 259264110107 1,332 284160276525 268 1,335 202 45626425122 43643210614135 2,046 1,639 178 285429113131 1,681 334177255595 304 1,569 115 59035896314131352,444 1,701 113 123LEGEND FIGURE 7 VOLUMES 2029 (NO BUILD + 5 YEARS)XXXXXXXXXAPPROACH MOVEMENTS INTERSECTION NODE NUMBER HOUR VOLUMES SCHOOL PM PEAK HOUR VOLUMES COMMUTER PM PEAK HOUR VOLUMES AM PEAK XXX DEVELOPMENT SITE FLOOR & DECOR RETAIL 1 5 2 34RD RETNEC EGALLIVRD DOOWTSEWRD DOOWTSAEEVA LLABMIK .SNL DEKOOR CRD NOCI LISRD NELON .SEVA LLABMIK .NNL YDAHSNL YRREHCRD RETNEC EGALLIV )DVLB EKALHTUOS( 9071 MF Sheet Number Sheet Title Checked By: Drawn By: Project No.: Issued: Scale: 7/26/2023MURILLO-4154RCH...\HALFF_CLR_PENTABLE.TBLPDF_2D_CLR_FW_MR_300.pltSheetA:\54000s\54063\001\TRANS\500 CADD\Sheets\TR-EXH-FIG8-54063.dgnHALFFah317910:53:31 AM7/26/2023CM SM 1" = 400' 54063(214) 346-6200RICHARDSON, TX 75081-22751201 NORTH BOWSER ROADFLOOR & DECORRETAIL DEVELOPMENTSOUTHLAKE, TEXASN 000030 0 0 0 0 0 0 50000 00000 0 0 0 0 5 0 00000 050 0 0 00000200 0 0 0 0 0 0 04000000000 0 0 0 0 5 0 2002000 0 200 400 600 800 SCALE: 1"=400'020LEGEND INBOUND PERCENTAGES FIGURE 8 X XXXINTERSECTION NODE NUMBER APPROACH MOVEMENTS FLOOR & DECOR PERCENTAGES - INBOUND TRIP DISTRIBUTION DEVELOPMENT SITE FLOOR & DECOR RETAIL 1 5 2 34RD RETNEC EGALLIVRD DOOWTSEWRD DOOWTSAEEVA LLABMIK .SNL DEKOOR CRD NOCI LISRD NELON .SEVA LLABMIK .NNL YDAHSNL YRREHCRD RETNEC EGALLIV )DVLB EKALHTUOS( 9071 MF Sheet Number Sheet Title Checked By: Drawn By: Project No.: Issued: Scale: 7/26/2023MURILLO-4154RCH...\HALFF_CLR_PENTABLE.TBLPDF_2D_CLR_FW_MR_300.pltSheetA:\54000s\54063\001\TRANS\500 CADD\Sheets\TR-EXH-FIG9-54063.dgnHALFFah317910:53:34 AM7/26/2023CM SM 1" = 400' 54063(214) 346-6200RICHARDSON, TX 75081-22751201 NORTH BOWSER ROADFLOOR & DECORRETAIL DEVELOPMENTSOUTHLAKE, TEXASN 500300 0 0 0 0 0 0 00000 00000 5 0 0 0 0 0 00000 005 0 0 020000020 0 40 0 0 0 0 000002020000 5 0 0 0 0 0 00000 0 200 400 600 800 SCALE: 1"=400'00LEGEND FIGURE 9 X XXXINTERSECTION NODE NUMBER APPROACH MOVEMENTS FLOOR & DECOR PERCENTAGES - OUTBOUND TRIP DISTRIBUTION OUTBOUND PERCENTAGES DEVELOPMENT SITE FLOOR & DECOR RETAIL 1 5 2 34RD RETNEC EGALLIVRD DOOWTSEWRD DOOWTSAEEVA LLABMIK .SNL DEKOOR CRD NOCI LISRD NELON .SEVA LLABMIK .NNL YDAHSNL YRREHCRD RETNEC EGALLIV )DVLB EKALHTUOS( 9071 MF X Sheet Number Sheet Title Checked By: Drawn By: Project No.: Issued: Scale: 7/26/2023MURILLO-4154RCH...\HALFF_CLR_PENTABLE.TBLPDF_2D_CLR_FW_MR_300.pltSheetA:\54000s\54063\001\TRANS\500 CADD\Sheets\TR-EXH-FIG10-54063.dgnHALFFah317910:53:36 AM7/26/2023CM SM 1" = 400' 54063(214) 346-6200RICHARDSON, TX 75081-22751201 NORTH BOWSER ROADFLOOR & DECORRETAIL DEVELOPMENTSOUTHLAKE, TEXASN 0 0 1317 0 0 0 00000000 2 0 0 0 0 0 3002121100 03 000000 0 0 3 3002117 0 0 0 0 0 00 3 0 0 00000000 0 2 0 0 3 0 00000002 00 000000 3 0 0 00000 3 0 0 0 0 23 0 0 00801401103209014011033 0 0 0 16 814 0 28 0 1800022000 0 0 0 0 0 0 000110900 00 0220000 0 0 0 0001114 0 28 0 0 0 00 3 0 0 000901100 9 2 0 0 3 0 1414008002 011 8011000 3 0 11 1414000 3 0 0 0 200 400 600 800 SCALE: 1"=400' LEGEND FIGURE 10 FLOOR & DECOR DEVELOPMENT TRIPS -XXXXXXXXXXXXAPPROACH MOVEMENTS INTERSECTION NODE NUMBER HOUR VOLUMES SCHOOL PM PEAK HOUR VOLUMES COMMUTER PM PEAK HOUR VOLUMES AM PEAK DEVELOPMENT SITE FLOOR & DECOR RETAIL 1 5 2 34RD RETNEC EGALLIVRD DOOWTSEWRD DOOWTSAEEVA LLABMIK .SNL DEKOOR CRD NOCI LISRD NELON .SEVA LLABMIK .NNL YDAHSNL YRREHCRD RETNEC EGALLIV )DVLB EKALHTUOS( 9071 MF X Sheet Number Sheet Title Checked By: Drawn By: Project No.: Issued: Scale: 7/26/2023MURILLO-4154RCH...\HALFF_CLR_PENTABLE.TBLPDF_2D_CLR_FW_MR_300.pltSheetA:\54000s\54063\001\TRANS\500 CADD\Sheets\TR-EXH-FIG11-54063.dgnHALFFah317910:53:38 AM7/26/2023CM SM 1" = 400' 54063(214) 346-6200RICHARDSON, TX 75081-22751201 NORTH BOWSER ROADFLOOR & DECORRETAIL DEVELOPMENTSOUTHLAKE, TEXASN 0 200 400 600 800 SCALE: 1"=400' 4 36 241900146143 14 147 1194292807 83 587 11111942794862 215 257 264371310 0 501145501470 21 0 15 28638186 131 646465340212141 3 0 1 3 118503126 5 59 490015 45 178 108 257 235252114221452614759 243 183 05241383 0 2723223851340 138 0 74 05340664054562 72 929670 13 12000 1 16 280374126 1 64 45317536226513 41 119 22584021163 130 30301602425396 275 104 3605341616 5713493241100 112 0 58 11582938829 9 61 10 2620 11 1,209 1,526 1,5421,2121,424 1,214 1,853 2,213 1,540 1,484 1,990 000 0 000 00000000 0 0000 0 0 0 0 00 00 0 0 00 LEGEND FIGURE 11 VOLUMES 2024 BUILDXXXXXXXXXXXXAPPROACH MOVEMENTS INTERSECTION NODE NUMBER HOUR VOLUMES SCHOOL PM PEAK HOUR VOLUMES COMMUTER PM PEAK HOUR VOLUMES AM PEAK DEVELOPMENT SITE FLOOR & DECOR RETAIL 1 5 2 34RD RETNEC EGALLIVRD DOOWTSEWRD DOOWTSAEEVA LLABMIK .SNL DEKOOR CRD NOCI LISRD NELON .SEVA LLABMIK .NNL YDAHSNL YRREHCRD RETNEC EGALLIV )DVLB EKALHTUOS( 9071 MF X Sheet Number Sheet Title Checked By: Drawn By: Project No.: Issued: Scale: 7/26/2023MURILLO-4154RCH...\HALFF_CLR_PENTABLE.TBLPDF_2D_CLR_FW_MR_300.pltSheetA:\54000s\54063\001\TRANS\500 CADD\Sheets\TR-EXH-FIG12-54063.dgnHALFFah317910:53:41 AM7/26/2023CM SM 1" = 400' 54063(214) 346-6200RICHARDSON, TX 75081-22751201 NORTH BOWSER ROADFLOOR & DECORRETAIL DEVELOPMENTSOUTHLAKE, TEXASN 165 050 17 16 3 5330202705 39 16 6 5400716338322772 70 1 50 395045 15 3 2378 01 30 17 0 1 0 10203703 0 0 14 0 1400000070000 1 11 0 2 07000 0 11 0 69 79 0 95 0 5809527250212010 9 0 0 253 80 0 0 21 16 0 5690281500 0 11 55 0 0 29125050265415 18 0 0 63 6518362 0 0 10 2 08818 91 2120 3 27 0 200 400 600 800 SCALE: 1"=400'7710214322647 123214307536 238 1,702 284 482553420511145 234155 131 1,340 2,197 161 259277124118 1,335 284160287525 268 1,338 202 456425145149 4474461061392,046 1,639 195 285443126142 1,684 334177266595 304 1,572 115 590358119121 6424271392,444 1,701 129 LEGEND FIGURE 12 VOLUMES 2029 (BUILD + 5 YEARS)XXXXXXXXXXXXAPPROACH MOVEMENTS INTERSECTION NODE NUMBER HOUR VOLUMES SCHOOL PM PEAK HOUR VOLUMES COMMUTER PM PEAK HOUR VOLUMES AM PEAK Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - D - Appendix D – Synchro Report Sheets Lanes, Volumes, Timings 2023 Existing AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 2 211 1510 252 7 73 573 109 1 190 279 71 Future Volume (vph) 2 211 1510 252 7 73 573 109 1 190 279 71 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 0.95 1.00 0.95 0.95 Frt 0.850 0.850 0.970 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3400 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3400 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 166 210 22 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Adj. Flow (vph) 2 220 1573 263 7 76 597 114 1 198 291 74 Shared Lane Traffic (%) Lane Group Flow (vph) 0 222 1573 263 0 83 597 114 0 199 365 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right R NA Left R NA Right Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 9 15 9 Number of Detectors 1 1 2 1 1 1 2 1 1 1 2 Detector Template Left Left Thru Right Left Left Thru Right Left Left Thru Leading Detector (ft) 20 20 100 20 20 20 100 20 20 20 100 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 20 6 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases 2 6 Lanes, Volumes, Timings 2023 Existing AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 2 Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 1 190 265 476 Future Volume (vph) 1 190 265 476 Ideal Flow (vphpl) 1900 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 0.95 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 0 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 0 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 337 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.96 0.96 0.96 0.96 Adj. Flow (vph) 1 198 276 496 Shared Lane Traffic (%) Lane Group Flow (vph) 0 199 276 496 Enter Blocked Intersection No No No No Lane Alignment R NA Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 Number of Detectors 1 1 2 1 Detector Template Left Left Thru Right Leading Detector (ft) 20 20 100 20 Trailing Detector (ft) 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot Prot NA Perm Protected Phases 7 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2023 Existing AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Detector Phase 5 5 2 2 1 1 6 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 12.0 45.0 Total Split (s) 27.0 27.0 48.0 48.0 18.0 18.0 39.0 39.0 35.0 35.0 35.0 Total Split (%) 20.8% 20.8% 36.9% 36.9% 13.8% 13.8% 30.0% 30.0% 26.9% 26.9% 26.9% Maximum Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 28.0 28.0 28.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lead Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 19.0 51.5 51.5 9.5 41.9 41.9 19.1 22.8 Actuated g/C Ratio 0.15 0.40 0.40 0.07 0.32 0.32 0.15 0.18 v/c Ratio 0.87 0.79 0.36 0.65 0.37 0.18 0.77 0.59 Control Delay 84.6 39.9 13.6 81.7 37.0 0.6 72.6 49.5 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 84.6 39.9 13.6 81.7 37.0 0.6 72.6 49.5 LOS F D B F D A E D Approach Delay 41.4 36.5 57.7 Approach LOS D D E 90th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 26.0 26.0 28.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Gap Gap Hold 70th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 22.0 22.0 28.1 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Gap Gap Hold 50th %ile Green (s) 21.8 21.8 46.6 46.6 10.5 10.5 35.3 35.3 19.1 19.1 25.9 50th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Hold 30th %ile Green (s) 18.9 18.9 57.5 57.5 8.7 8.7 47.3 47.3 16.3 16.3 19.6 30th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Hold 10th %ile Green (s) 14.5 14.5 71.2 71.2 6.1 6.1 62.8 62.8 12.1 12.1 12.6 10th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Gap Queue Length 50th (ft) 180 450 56 69 152 0 164 137 Queue Length 95th (ft) #317 #596 139 125 199 0 236 185 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 274 1993 721 148 1622 647 377 750 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 0.81 0.79 0.36 0.56 0.37 0.18 0.53 0.49 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2023 Existing AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 4 Lane Group SBU SBL SBT SBR Detector Phase 7 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 43.0 43.0 Total Split (s) 29.0 29.0 29.0 29.0 Total Split (%) 22.3% 22.3% 22.3% 22.3% Maximum Green (s) 22.0 22.0 22.0 22.0 Yellow Time (s) 4.0 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 Recall Mode None None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 18.2 22.0 22.0 Actuated g/C Ratio 0.14 0.17 0.17 v/c Ratio 0.81 0.47 0.91 Control Delay 78.1 50.6 38.2 Queue Delay 0.0 0.0 0.0 Total Delay 78.1 50.6 38.2 LOS E D D Approach Delay 49.9 Approach LOS D 90th %ile Green (s) 22.0 22.0 24.0 24.0 90th %ile Term Code Max Max Max Max 70th %ile Green (s) 21.9 21.9 28.0 28.0 70th %ile Term Code Gap Gap Max Max 50th %ile Green (s) 19.0 19.0 25.8 25.8 50th %ile Term Code Gap Gap Gap Gap 30th %ile Green (s) 16.2 16.2 19.5 19.5 30th %ile Term Code Gap Gap Gap Gap 10th %ile Green (s) 12.1 12.1 12.6 12.6 10th %ile Term Code Gap Gap Hold Hold Queue Length 50th (ft) 164 107 138 Queue Length 95th (ft) 245 154 #345 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 296 656 567 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.67 0.42 0.87 Intersection Summary Lanes, Volumes, Timings 2023 Existing AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 5 Cycle Length: 130 Actuated Cycle Length: 130 Offset: 5 (4%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 120 Control Type: Actuated-Coordinated Maximum v/c Ratio: 0.91 Intersection Signal Delay: 44.5 Intersection LOS: D Intersection Capacity Utilization 86.3% ICU Level of Service E Analysis Period (min) 15 # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2023 Existing AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 48 35 29 27 39 29 35 Maximum Split (%) 13.8% 36.9% 26.9% 22.3% 20.8% 30.0% 22.3% 26.9% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 76 94 12 47 76 103 12 41 End Time (s) 94 12 47 76 103 12 41 76 Yield/Force Off (s) 87 5 40 69 96 5 34 69 Yield/Force Off 170(s) 87 109 40 40 96 110 34 38 Local Start Time (s) 71 89 7 42 71 98 7 36 Local Yield (s) 82 0 35 64 91 0 29 64 Local Yield 170(s) 82 104 35 35 91 105 29 33 Intersection Summary Cycle Length 130 Control Type Actuated-Coordinated Natural Cycle 120 Offset: 5 (4%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2023 Existing AM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 1 Intersection Int Delay, s/veh 1.5 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 5 0 7 10 0 49 17 428 13 11 44 491 29 Future Vol, veh/h 5 0 7 10 0 49 17 428 13 11 44 491 29 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free RT Channelized - - None - - None - - None - - - None Storage Length - - 100 - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - 0 - - - 0 - Grade, % - 0 - - 0 - - 0 - - - 0 - Peak Hour Factor 83 83 83 83 83 83 83 83 83 92 83 83 83 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 6 0 8 12 0 59 20 516 16 12 53 592 35 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 1020 1294 296 990 1321 266 627 0 0 531 532 0 0 Stage 1 722 722 - 564 564 - - - - - - - - Stage 2 298 572 - 426 757 - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 189 160 697 199 154 729 944 - - 657 1025 - - Stage 1 382 427 - 475 504 - - - - - - - - Stage 2 683 500 - 574 411 - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 162 145 697 183 140 729 944 - - 912 912 - - Mov Cap-2 Maneuver 162 145 - 183 140 - - - - - - - - Stage 1 374 397 - 465 493 - - - - - - - - Stage 2 614 490 - 527 382 - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 17.7 13.7 0.3 0.9 HCM LOS C B Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 944 - - 162 697 484 912 - - HCM Lane V/C Ratio 0.022 - - 0.037 0.012 0.147 0.071 - - HCM Control Delay (s) 8.9 - - 28.1 10.2 13.7 9.2 - - HCM Lane LOS A - - D B B A - - HCM 95th %tile Q(veh) 0.1 - - 0.1 0 0.5 0.2 - - HCM 6th TWSC 2023 Existing AM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 2 Intersection Int Delay, s/veh 6.2 Movement EBL EBR NBU NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 84 127 2 82 365 6 447 64 Future Vol, veh/h 84 127 2 82 365 6 447 64 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free Free RT Channelized - None - - None - - None Storage Length 100 0 - 160 - - - 110 Veh in Median Storage, # 0 - - - 0 - 0 - Grade, % 0 - - - 0 - 0 - Peak Hour Factor 73 73 92 73 73 92 73 73 Heavy Vehicles, % 3 3 3 3 3 3 3 3 Mvmt Flow 115 174 2 112 500 7 612 88 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 1104 306 612 700 0 500 - 0 Stage 1 626 - - - - - - - Stage 2 478 - - - - - - - Critical Hdwy 6.86 6.96 6.46 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - - Follow-up Hdwy 3.53 3.33 2.53 2.23 - 2.53 - - Pot Cap-1 Maneuver 204 687 584 886 - 688 - - Stage 1 493 - - - - - - - Stage 2 587 - - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 174 687 872 872 - 688 - - Mov Cap-2 Maneuver 174 - - - - - - - Stage 1 428 - - - - - - - Stage 2 577 - - - - - - - Approach EB NB SB HCM Control Delay, s 30.7 1.8 0.1 HCM LOS D Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 872 - 174 687 - - HCM Lane V/C Ratio 0.131 - 0.661 0.253 - - HCM Control Delay (s) 9.8 - 58.9 12 - - HCM Lane LOS A - F B - - HCM 95th %tile Q(veh) 0.5 - 3.8 1 - - HCM 6th TWSC 2023 Existing AM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 3 Intersection Int Delay, s/veh 2.1 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 3 14 1951 131 4 33 1190 14 8 0 22 6 0 14 Future Vol, veh/h 3 14 1951 131 4 33 1190 14 8 0 22 6 0 14 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - None Storage Length - 345 - 180 - 200 - - - - 100 - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - 0 - Grade, % - - 0 - - - 0 - - 0 - - 0 - Peak Hour Factor 92 95 95 95 92 95 95 95 95 95 95 95 95 95 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 5 3 3 3 Mvmt Flow 3 15 2054 138 4 35 1253 15 8 0 23 6 0 15 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 925 1268 0 0 1499 2192 0 0 2669 3436 1027 2197 3567 634 Stage 1 - - - - - - - - 2090 2090 - 1339 1339 - Stage 2 - - - - - - - - 579 1346 - 858 2228 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.2 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.95 3.83 4.03 3.93 Pot Cap-1 Maneuver 480 287 - - 229 98 - - 24 7 195 47 5 360 Stage 1 - - - - - - - - 33 92 - 114 218 - Stage 2 - - - - - - - - 424 216 - 286 78 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 308 308 - - 104 104 - - 16 4 195 28 3 360 Mov Cap-2 Maneuver - - - - - - - - 16 4 - 28 3 - Stage 1 - - - - - - - - 31 87 - 107 136 - Stage 2 - - - - - - - - 254 135 - 237 73 - Approach EB WB NB SB HCM Control Delay, s 0.1 1.8 119.7 61.1 HCM LOS F F Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) 16 195 308 - - 104 - - 28 360 HCM Lane V/C Ratio 0.526 0.119 0.058 - - 0.376 - - 0.226 0.041 HCM Control Delay (s) $ 377.7 25.9 17.4 - - 59.1 - - 167.7 15.4 HCM Lane LOS F D C - - F - - F C HCM 95th %tile Q(veh) 1.4 0.4 0.2 - - 1.5 - - 0.7 0.1 HCM 6th TWSC 2023 Existing AM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 4 Intersection Int Delay, s/veh 10.5 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 1 1 116 138 1 0 33 0 208 0 0 0 Future Vol, veh/h 1 1 116 138 1 0 33 0 208 0 0 0 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 53 53 53 53 53 53 53 53 53 53 53 53 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 2 2 219 260 2 0 62 0 392 0 0 0 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 2 0 0 221 0 0 638 638 112 834 747 2 Stage 1 - - - - - - 116 116 - 522 522 - Stage 2 - - - - - - 522 522 - 312 225 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1614 - - 1342 - - 388 393 938 286 340 1079 Stage 1 - - - - - - 886 798 - 536 529 - Stage 2 - - - - - - 536 529 - 696 716 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1614 - - 1342 - - 330 316 938 141 274 1079 Mov Cap-2 Maneuver - - - - - - 330 316 - 141 274 - Stage 1 - - - - - - 885 797 - 535 426 - Stage 2 - - - - - - 432 426 - 404 715 - Approach EB WB NB SB HCM Control Delay, s 0.1 8.3 16.9 0 HCM LOS C A Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 749 1614 - - 1342 - - - HCM Lane V/C Ratio 0.607 0.001 - - 0.194 - - - HCM Control Delay (s) 16.9 7.2 - - 8.3 - - 0 HCM Lane LOS C A - - A - - A HCM 95th %tile Q(veh) 4.2 0 - - 0.7 - - - Lanes, Volumes, Timings 2023 Existing School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU Lane Configurations Traffic Volume (vph) 9 238 1185 179 2 95 1183 252 230 234 98 2 Future Volume (vph) 9 238 1185 179 2 95 1183 252 230 234 98 2 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 1.00 0.95 0.95 0.95 Frt 0.850 0.850 0.956 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 1752 3351 0 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 1752 3351 0 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 137 182 39 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 Adj. Flow (vph) 9 251 1247 188 2 100 1245 265 242 246 103 2 Shared Lane Traffic (%) Lane Group Flow (vph) 0 260 1247 188 0 102 1245 265 242 349 0 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right Left R NA Right R NA Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 15 9 9 Number of Detectors 1 1 2 1 1 1 2 1 1 2 1 Detector Template Left Left Thru Right Left Left Thru Right Left Thru Left Leading Detector (ft) 20 20 100 20 20 20 100 20 20 100 20 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot NA Prot Protected Phases 5 5 2 1 1 6 3 8 7 Permitted Phases 2 6 Lanes, Volumes, Timings 2023 Existing School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 2 Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 142 245 466 Future Volume (vph) 142 245 466 Ideal Flow (vphpl) 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 256 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.95 0.95 0.95 Adj. Flow (vph) 149 258 491 Shared Lane Traffic (%) Lane Group Flow (vph) 151 258 491 Enter Blocked Intersection No No No Lane Alignment Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 Turning Speed (mph) 15 9 Number of Detectors 1 2 1 Detector Template Left Thru Right Leading Detector (ft) 20 100 20 Trailing Detector (ft) 0 0 0 Detector 1 Position(ft) 0 0 0 Detector 1 Size(ft) 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot NA Perm Protected Phases 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2023 Existing School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU Detector Phase 5 5 2 2 1 1 6 6 3 8 7 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 45.0 12.0 Total Split (s) 31.0 31.0 60.0 60.0 18.0 18.0 47.0 47.0 30.0 41.0 31.0 Total Split (%) 20.7% 20.7% 40.0% 40.0% 12.0% 12.0% 31.3% 31.3% 20.0% 27.3% 20.7% Maximum Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 34.0 24.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lag Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 24.2 59.0 59.0 11.0 45.8 45.8 22.2 34.8 Actuated g/C Ratio 0.16 0.39 0.39 0.07 0.31 0.31 0.15 0.23 v/c Ratio 0.92 0.63 0.27 0.80 0.81 0.44 0.93 0.43 Control Delay 98.1 39.7 11.3 107.2 54.2 16.8 104.1 44.6 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 98.1 39.7 11.3 107.2 54.2 16.8 104.1 44.6 LOS F D B F D B F D Approach Delay 45.5 51.4 69.0 Approach LOS D D E 90th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 34.3 23.7 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 70th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 38.0 20.0 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 50th %ile Green (s) 25.1 25.1 53.0 53.0 12.1 12.1 40.0 40.0 23.0 39.6 17.3 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 30th %ile Green (s) 26.4 26.4 59.5 59.5 11.9 11.9 45.0 45.0 23.0 36.0 14.6 30th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Max Hold Gap 10th %ile Green (s) 21.4 21.4 76.5 76.5 8.8 8.8 63.9 63.9 19.2 26.0 10.7 10th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Hold Gap Queue Length 50th (ft) 252 383 33 99 437 63 236 129 Queue Length 95th (ft) #428 439 93 #204 #523 153 #399 186 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 288 1980 699 133 1536 604 268 842 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 0.90 0.63 0.27 0.77 0.81 0.44 0.90 0.41 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2023 Existing School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 4 Lane Group SBL SBT SBR Detector Phase 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 12.0 43.0 43.0 Total Split (s) 31.0 42.0 42.0 Total Split (%) 20.7% 28.0% 28.0% Maximum Green (s) 24.0 35.0 35.0 Yellow Time (s) 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 Recall Mode None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 17.3 29.8 29.8 Actuated g/C Ratio 0.12 0.20 0.20 v/c Ratio 0.75 0.37 0.95 Control Delay 86.0 52.5 56.6 Queue Delay 0.0 0.0 0.0 Total Delay 86.0 52.5 56.6 LOS F D E Approach Delay 60.3 Approach LOS E 90th %ile Green (s) 23.7 35.0 35.0 90th %ile Term Code Gap Max Max 70th %ile Green (s) 20.0 35.0 35.0 70th %ile Term Code Gap Max Max 50th %ile Green (s) 17.3 33.9 33.9 50th %ile Term Code Gap Gap Gap 30th %ile Green (s) 14.6 27.6 27.6 30th %ile Term Code Gap Gap Gap 10th %ile Green (s) 10.7 17.5 17.5 10th %ile Term Code Gap Gap Gap Queue Length 50th (ft) 145 112 246 Queue Length 95th (ft) 216 153 #450 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 280 817 562 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.54 0.32 0.87 Intersection Summary Lanes, Volumes, Timings 2023 Existing School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 5 Cycle Length: 150 Actuated Cycle Length: 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 130 Control Type: Actuated-Coordinated Maximum v/c Ratio: 0.95 Intersection Signal Delay: 53.2 Intersection LOS: D Intersection Capacity Utilization 101.5% ICU Level of Service G Analysis Period (min) 15 # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2023 Existing School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 60 30 42 31 47 31 41 Maximum Split (%) 12.0% 40.0% 20.0% 28.0% 20.7% 31.3% 20.7% 27.3% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 84 102 12 42 84 115 12 43 End Time (s) 102 12 42 84 115 12 43 84 Yield/Force Off (s) 95 5 35 77 108 5 36 77 Yield/Force Off 170(s) 95 129 35 48 108 130 36 46 Local Start Time (s) 79 97 7 37 79 110 7 38 Local Yield (s) 90 0 30 72 103 0 31 72 Local Yield 170(s) 90 124 30 43 103 125 31 41 Intersection Summary Cycle Length 150 Control Type Actuated-Coordinated Natural Cycle 130 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2023 Existing School PM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 1 Intersection Int Delay, s/veh 8.7 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 108 0 59 3 0 26 40 405 8 23 22 377 109 Future Vol, veh/h 108 0 59 3 0 26 40 405 8 23 22 377 109 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free RT Channelized - - None - - None - - None - - - None Storage Length - - 100 - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - 0 - - - 0 - Grade, % - 0 - - 0 - - 0 - - - 0 - Peak Hour Factor 76 76 76 76 76 76 76 76 76 92 76 76 76 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 142 0 78 4 0 34 53 533 11 25 29 496 143 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 977 1254 248 1001 1392 272 639 0 0 543 544 0 0 Stage 1 604 604 - 645 645 - - - - - - - - Stage 2 373 650 - 356 747 - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 204 169 749 196 140 723 934 - - 646 1014 - - Stage 1 450 484 - 425 463 - - - - - - - - Stage 2 617 461 - 632 416 - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 176 148 749 159 123 723 934 - - 786 786 - - Mov Cap-2 Maneuver 176 148 - 159 123 - - - - - - - - Stage 1 424 451 - 401 437 - - - - - - - - Stage 2 554 435 - 528 387 - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 54.5 12.3 0.8 0.8 HCM LOS F B Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 934 - - 176 749 529 786 - - HCM Lane V/C Ratio 0.056 - - 0.807 0.104 0.072 0.069 - - HCM Control Delay (s) 9.1 - - 78.6 10.4 12.3 9.9 - - HCM Lane LOS A - - F B B A - - HCM 95th %tile Q(veh) 0.2 - - 5.5 0.3 0.2 0.2 - - HCM 6th TWSC 2023 Existing School PM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 2 Intersection Int Delay, s/veh 3.6 Movement EBL EBR NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 61 67 49 387 6 384 44 Future Vol, veh/h 61 67 49 387 6 384 44 Conflicting Peds, #/hr 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free RT Channelized - None - None - - None Storage Length 100 0 160 - - - 110 Veh in Median Storage, # 0 - - 0 - 0 - Grade, % 0 - - 0 - 0 - Peak Hour Factor 65 65 65 65 92 65 65 Heavy Vehicles, % 3 3 3 3 3 3 3 Mvmt Flow 94 103 75 595 7 591 68 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 1053 296 659 0 595 - 0 Stage 1 605 - - - - - - Stage 2 448 - - - - - - Critical Hdwy 6.86 6.96 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - Follow-up Hdwy 3.53 3.33 2.23 - 2.53 - - Pot Cap-1 Maneuver 220 697 918 - 599 - - Stage 1 505 - - - - - - Stage 2 608 - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 198 697 918 - 599 - - Mov Cap-2 Maneuver 198 - - - - - - Stage 1 464 - - - - - - Stage 2 596 - - - - - - Approach EB NB SB HCM Control Delay, s 24.2 1 0.1 HCM LOS C Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 918 - 198 697 - - HCM Lane V/C Ratio 0.082 - 0.474 0.148 - - HCM Control Delay (s) 9.3 - 38.6 11.1 - - HCM Lane LOS A - E B - - HCM 95th %tile Q(veh) 0.3 - 2.3 0.5 - - HCM 6th TWSC 2023 Existing School PM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 3 Intersection Int Delay, s/veh 1.4 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 15 44 1455 158 5 55 1817 48 29 3 120 3 1 3 74 Future Vol, veh/h 15 44 1455 158 5 55 1817 48 29 3 120 3 1 3 74 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - - None Storage Length - 345 - 180 - 200 - - - - 100 - - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - - 0 - Grade, % - - 0 - - - 0 - - 0 - - - 0 - Peak Hour Factor 92 95 95 95 92 95 95 95 95 95 95 92 95 95 95 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 16 46 1532 166 5 58 1913 51 31 3 126 3 1 3 78 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1433 1964 0 0 1118 1698 0 0 2549 3746 766 0 2803 3887 982 Stage 1 - - - - - - - - 1656 1656 - 0 2065 2065 - Stage 2 - - - - - - - - 893 2090 - 0 738 1822 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.16 - 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.93 - 3.83 4.03 3.93 Pot Cap-1 Maneuver 249 129 - - 374 176 - - ~ 28 4 295 0 19 ~ 3 212 Stage 1 - - - - - - - - 68 152 - 0 34 94 - Stage 2 - - - - - - - - 272 92 - 0 339 126 - Platoon blocked, % - - - - - Mov Cap-1 Maneuver 136 136 - - 179 179 - - - ~ 1 295 0 - ~ 1 212 Mov Cap-2 Maneuver - - - - - - - - - ~ 1 - 0 - ~ 1 - Stage 1 - - - - - - - - 37 82 - 0 18 61 - Stage 2 - - - - - - - - 106 60 - 0 100 68 - Approach EB WB NB SB HCM Control Delay, s 1.9 1.1 HCM LOS - - Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) - 295 136 - - 179 - - - 212 HCM Lane V/C Ratio - 0.428 0.46 - - 0.354 - - - 0.367 HCM Control Delay (s) - 26 52.1 - - 35.7 - - - 31.5 HCM Lane LOS - D F - - E - - - D HCM 95th %tile Q(veh) - 2 2.1 - - 1.5 - - - 1.6 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2023 Existing School PM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 4 Intersection Int Delay, s/veh 8.2 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 1 12 27 69 10 12 9 2 94 20 0 6 Future Vol, veh/h 1 12 27 69 10 12 9 2 94 20 0 6 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 39 39 39 39 39 39 39 39 39 39 39 39 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 3 31 69 177 26 31 23 5 241 51 0 15 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 57 0 0 100 0 0 475 483 66 591 502 42 Stage 1 - - - - - - 72 72 - 396 396 - Stage 2 - - - - - - 403 411 - 195 106 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1541 - - 1486 - - 498 482 995 417 470 1026 Stage 1 - - - - - - 935 833 - 627 602 - Stage 2 - - - - - - 622 593 - 804 806 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1541 - - 1486 - - 445 424 995 284 413 1026 Mov Cap-2 Maneuver - - - - - - 445 424 - 284 413 - Stage 1 - - - - - - 933 831 - 626 530 - Stage 2 - - - - - - 540 522 - 604 804 - Approach EB WB NB SB HCM Control Delay, s 0.2 5.9 10.9 18.1 HCM LOS B C Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 879 1541 - - 1486 - - 341 HCM Lane V/C Ratio 0.306 0.002 - - 0.119 - - 0.196 HCM Control Delay (s) 10.9 7.3 - - 7.8 - - 18.1 HCM Lane LOS B A - - A - - C HCM 95th %tile Q(veh) 1.3 0 - - 0.4 - - 0.7 Lanes, Volumes, Timings 2023 Existing Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 6 270 1393 102 3 116 1493 297 2 253 381 100 Future Volume (vph) 6 270 1393 102 3 116 1493 297 2 253 381 100 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 0.95 1.00 0.95 0.95 Frt 0.850 0.850 0.969 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3396 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3396 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 131 182 20 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Adj. Flow (vph) 6 281 1451 106 3 121 1555 309 2 264 397 104 Shared Lane Traffic (%) Lane Group Flow (vph) 0 287 1451 106 0 124 1555 309 0 266 501 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right R NA Left R NA Right Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 9 15 9 Number of Detectors 1 1 2 1 1 1 2 1 1 1 2 Detector Template Left Left Thru Right Left Left Thru Right Left Left Thru Leading Detector (ft) 20 20 100 20 20 20 100 20 20 20 100 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 20 6 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases 2 6 Lanes, Volumes, Timings 2023 Existing Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 2 Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 157 226 528 Future Volume (vph) 157 226 528 Ideal Flow (vphpl) 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 253 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.96 0.96 0.96 Adj. Flow (vph) 164 235 550 Shared Lane Traffic (%) Lane Group Flow (vph) 164 235 550 Enter Blocked Intersection No No No Lane Alignment Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 Turning Speed (mph) 15 9 Number of Detectors 1 2 1 Detector Template Left Thru Right Leading Detector (ft) 20 100 20 Trailing Detector (ft) 0 0 0 Detector 1 Position(ft) 0 0 0 Detector 1 Size(ft) 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot NA Perm Protected Phases 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2023 Existing Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Detector Phase 5 5 2 2 1 1 6 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 12.0 45.0 Total Split (s) 31.0 31.0 60.0 60.0 18.0 18.0 47.0 47.0 30.0 30.0 41.0 Total Split (%) 20.7% 20.7% 40.0% 40.0% 12.0% 12.0% 31.3% 31.3% 20.0% 20.0% 27.3% Maximum Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 34.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lead Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 24.2 53.0 53.0 11.2 40.0 40.0 23.0 39.7 Actuated g/C Ratio 0.16 0.35 0.35 0.07 0.27 0.27 0.15 0.26 v/c Ratio 1.02 0.82 0.17 0.95 1.16 0.56 0.99 0.55 Control Delay 118.5 48.6 3.0 134.1 128.1 23.0 115.4 49.0 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 118.5 48.6 3.0 134.1 128.1 23.0 115.4 49.0 LOS F D A F F C F D Approach Delay 56.9 112.2 72.0 Approach LOS E F E 90th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 34.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 70th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 36.9 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 50th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 39.6 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 30th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 42.4 30th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 10th %ile Green (s) 25.0 25.0 53.0 53.0 12.0 12.0 40.0 40.0 23.0 23.0 45.4 10th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold Queue Length 50th (ft) ~298 471 0 123 ~656 105 264 214 Queue Length 95th (ft) #491 534 25 #261 #753 208 #452 290 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 282 1779 638 130 1342 551 268 912 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 1.02 0.82 0.17 0.95 1.16 0.56 0.99 0.55 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2023 Existing Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 4 Lane Group SBL SBT SBR Detector Phase 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 12.0 43.0 43.0 Total Split (s) 31.0 42.0 42.0 Total Split (%) 20.7% 28.0% 28.0% Maximum Green (s) 24.0 35.0 35.0 Yellow Time (s) 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 Recall Mode None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 18.1 34.8 34.8 Actuated g/C Ratio 0.12 0.23 0.23 v/c Ratio 0.78 0.29 0.99 Control Delay 87.1 48.5 65.4 Queue Delay 0.0 0.0 0.0 Total Delay 87.1 48.5 65.4 LOS F D E Approach Delay 65.0 Approach LOS E 90th %ile Green (s) 24.0 35.0 35.0 90th %ile Term Code Max Max Max 70th %ile Green (s) 21.1 35.0 35.0 70th %ile Term Code Gap Max Max 50th %ile Green (s) 18.4 35.0 35.0 50th %ile Term Code Gap Max Max 30th %ile Green (s) 15.6 35.0 35.0 30th %ile Term Code Gap Max Max 10th %ile Green (s) 11.6 34.0 34.0 10th %ile Term Code Gap Gap Gap Queue Length 50th (ft) 158 100 330 Queue Length 95th (ft) 232 141 #582 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 280 817 559 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.59 0.29 0.98 Intersection Summary Lanes, Volumes, Timings 2023 Existing Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 5 Cycle Length: 150 Actuated Cycle Length: 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 150 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.16 Intersection Signal Delay: 80.2 Intersection LOS: F Intersection Capacity Utilization 114.3% ICU Level of Service H Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2023 Existing Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 60 30 42 31 47 31 41 Maximum Split (%) 12.0% 40.0% 20.0% 28.0% 20.7% 31.3% 20.7% 27.3% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 84 102 12 42 84 115 12 43 End Time (s) 102 12 42 84 115 12 43 84 Yield/Force Off (s) 95 5 35 77 108 5 36 77 Yield/Force Off 170(s) 95 129 35 48 108 130 36 46 Local Start Time (s) 79 97 7 37 79 110 7 38 Local Yield (s) 90 0 30 72 103 0 31 72 Local Yield 170(s) 90 124 30 43 103 125 31 41 Intersection Summary Cycle Length 150 Control Type Actuated-Coordinated Natural Cycle 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2023 Existing Commuter PM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 1 Intersection Int Delay, s/veh 4.5 Movement EBL EBT EBR WBL WBT WBR NBU NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 83 0 43 16 0 56 3 48 524 16 13 48 318 86 Future Vol, veh/h 83 0 43 16 0 56 3 48 524 16 13 48 318 86 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free Free RT Channelized - - None - - None - - - None - - - None Storage Length - - 100 - - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - - 0 - - - 0 - Grade, % - 0 - - 0 - - - 0 - - - 0 - Peak Hour Factor 92 92 92 92 92 92 92 92 92 92 92 92 92 92 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 90 0 47 17 0 61 3 52 570 17 14 52 346 93 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 873 1175 173 994 1260 294 346 439 0 0 587 587 0 0 Stage 1 478 478 - 689 689 - - - - - - - - - Stage 2 395 697 - 305 571 - - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 6.46 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.53 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 243 189 837 198 168 699 862 1110 - - 606 977 - - Stage 1 535 551 - 400 442 - - - - - - - - - Stage 2 599 438 - 677 501 - - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 200 165 837 169 147 699 1087 1087 - - 842 842 - - Mov Cap-2 Maneuver 200 165 - 169 147 - - - - - - - - - Stage 1 508 508 - 380 419 - - - - - - - - - Stage 2 519 416 - 589 462 - - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 27.6 15.8 0.7 1.3 HCM LOS D C Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 1087 - - 200 837 412 842 - - HCM Lane V/C Ratio 0.051 - - 0.451 0.056 0.19 0.079 - - HCM Control Delay (s) 8.5 - - 37 9.6 15.8 9.6 - - HCM Lane LOS A - - E A C A - - HCM 95th %tile Q(veh) 0.2 - - 2.1 0.2 0.7 0.3 - - HCM 6th TWSC 2023 Existing Commuter PM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 2 Intersection Int Delay, s/veh 0.4 Movement EBL EBR NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 9 5 8 560 9 367 2 Future Vol, veh/h 9 5 8 560 9 367 2 Conflicting Peds, #/hr 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free RT Channelized - None - None - - None Storage Length 100 0 160 - - - 110 Veh in Median Storage, # 0 - - 0 - 0 - Grade, % 0 - - 0 - 0 - Peak Hour Factor 83 83 83 83 92 83 83 Heavy Vehicles, % 3 3 3 3 3 3 3 Mvmt Flow 11 6 10 675 10 442 2 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 820 221 444 0 675 - 0 Stage 1 462 - - - - - - Stage 2 358 - - - - - - Critical Hdwy 6.86 6.96 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - Follow-up Hdwy 3.53 3.33 2.23 - 2.53 - - Pot Cap-1 Maneuver 311 780 1105 - 532 - - Stage 1 598 - - - - - - Stage 2 675 - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 300 780 1105 - 532 - - Mov Cap-2 Maneuver 300 - - - - - - Stage 1 593 - - - - - - Stage 2 658 - - - - - - Approach EB NB SB HCM Control Delay, s 14.7 0.1 0.3 HCM LOS B Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 1105 - 300 780 - - HCM Lane V/C Ratio 0.009 - 0.036 0.008 - - HCM Control Delay (s) 8.3 - 17.5 9.7 - - HCM Lane LOS A - C A - - HCM 95th %tile Q(veh) 0 - 0.1 0 - - HCM 6th TWSC 2023 Existing Commuter PM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 3 Intersection Int Delay, s/veh 20.3 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 13 40 1510 100 1 60 2170 44 16 4 120 6 2 2 64 Future Vol, veh/h 13 40 1510 100 1 60 2170 44 16 4 120 6 2 2 64 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - - None Storage Length - 345 - 180 - 200 - - - - 100 - - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - - 0 - Grade, % - - 0 - - - 0 - - 0 - - - 0 - Peak Hour Factor 92 96 96 96 92 96 96 96 96 96 96 92 96 96 96 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 14 42 1573 104 1 63 2260 46 17 4 125 7 2 2 67 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1684 2306 0 0 1148 1677 0 0 2718 4119 787 0 3154 4200 1153 Stage 1 - - - - - - - - 1685 1685 - 0 2411 2411 - Stage 2 - - - - - - - - 1033 2434 - 0 743 1789 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.16 - 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.93 - 3.83 4.03 3.93 Pot Cap-1 Maneuver 180 86 - - 360 180 - - 22 ~ 2 285 0 11 ~ 2 163 Stage 1 - - - - - - - - 65 147 - 0 19 62 - Stage 2 - - - - - - - - 223 61 - 0 337 131 - Platoon blocked, % - - - - - Mov Cap-1 Maneuver 91 91 - - 180 180 - - ~ 5 0 285 0 ~ 2 0 163 Mov Cap-2 Maneuver - - - - - - - - ~ 5 0 - 0 ~ 2 0 - Stage 1 - - - - - - - - 25 56 - 0 7 40 - Stage 2 - - - - - - - - 81 39 - 0 67 50 - Approach EB WB NB SB HCM Control Delay, s 3 1 $ 423.3 237.4 HCM LOS F F Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) 5 285 91 - - 180 - - 2 163 HCM Lane V/C Ratio 4.167 0.439 0.613 - - 0.353 - - 2.083 0.409 HCM Control Delay (s) $ 2800.5 27.1 93.8 - - 35.4 - -$ 3370.5 41.6 HCM Lane LOS F D F - - E - - F E HCM 95th %tile Q(veh) 4 2.1 2.9 - - 1.5 - - 1.4 1.8 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2023 Existing Commuter PM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 4 Intersection Int Delay, s/veh 2.5 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 0 7 0 1 7 2 0 0 6 0 0 0 Future Vol, veh/h 0 7 0 1 7 2 0 0 6 0 0 0 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 82 82 82 82 82 82 82 82 82 82 82 82 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 0 9 0 1 9 2 0 0 7 0 0 0 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 11 0 0 9 0 0 21 22 9 25 21 10 Stage 1 - - - - - - 9 9 - 12 12 - Stage 2 - - - - - - 12 13 - 13 9 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1602 - - 1604 - - 989 870 1070 983 871 1068 Stage 1 - - - - - - 1010 886 - 1006 884 - Stage 2 - - - - - - 1006 883 - 1005 886 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1602 - - 1604 - - 989 869 1070 976 870 1068 Mov Cap-2 Maneuver - - - - - - 989 869 - 976 870 - Stage 1 - - - - - - 1010 886 - 1006 883 - Stage 2 - - - - - - 1005 882 - 998 886 - Approach EB WB NB SB HCM Control Delay, s 0 0.7 8.4 0 HCM LOS A A Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 1070 1602 - - 1604 - - - HCM Lane V/C Ratio 0.007 - - - 0.001 - - - HCM Control Delay (s) 8.4 0 - - 7.2 - - 0 HCM Lane LOS A A - - A - - A HCM 95th %tile Q(veh) 0 0 - - 0 - - - Lanes, Volumes, Timings 2024 No Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 2 215 1540 257 7 74 584 111 1 194 285 72 Future Volume (vph) 2 215 1540 257 7 74 584 111 1 194 285 72 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 0.95 1.00 0.95 0.95 Frt 0.850 0.850 0.970 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3400 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3400 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 166 210 22 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Adj. Flow (vph) 2 224 1604 268 7 77 608 116 1 202 297 75 Shared Lane Traffic (%) Lane Group Flow (vph) 0 226 1604 268 0 84 608 116 0 203 372 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right R NA Left R NA Right Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 9 15 9 Number of Detectors 1 1 2 1 1 1 2 1 1 1 2 Detector Template Left Left Thru Right Left Left Thru Right Left Left Thru Leading Detector (ft) 20 20 100 20 20 20 100 20 20 20 100 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 20 6 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases 2 6 Lanes, Volumes, Timings 2024 No Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 2 Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 1 194 270 486 Future Volume (vph) 1 194 270 486 Ideal Flow (vphpl) 1900 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 0.95 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 0 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 0 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 333 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.96 0.96 0.96 0.96 Adj. Flow (vph) 1 202 281 506 Shared Lane Traffic (%) Lane Group Flow (vph) 0 203 281 506 Enter Blocked Intersection No No No No Lane Alignment R NA Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 Number of Detectors 1 1 2 1 Detector Template Left Left Thru Right Leading Detector (ft) 20 20 100 20 Trailing Detector (ft) 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot Prot NA Perm Protected Phases 7 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2024 No Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Detector Phase 5 5 2 2 1 1 6 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 12.0 45.0 Total Split (s) 27.0 27.0 48.0 48.0 18.0 18.0 39.0 39.0 35.0 35.0 35.0 Total Split (%) 20.8% 20.8% 36.9% 36.9% 13.8% 13.8% 30.0% 30.0% 26.9% 26.9% 26.9% Maximum Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 28.0 28.0 28.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lead Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 19.3 50.1 50.1 9.5 40.3 40.3 19.4 23.9 Actuated g/C Ratio 0.15 0.39 0.39 0.07 0.31 0.31 0.15 0.18 v/c Ratio 0.87 0.83 0.38 0.66 0.39 0.18 0.78 0.58 Control Delay 84.4 42.2 14.3 82.1 38.2 0.6 72.6 48.5 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 84.4 42.2 14.3 82.1 38.2 0.6 72.6 48.5 LOS F D B F D A E D Approach Delay 43.1 37.4 57.0 Approach LOS D D E 90th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 26.4 26.4 28.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Gap Gap Hold 70th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 22.3 22.3 28.0 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Gap Gap Hold 50th %ile Green (s) 22.3 22.3 43.9 43.9 10.6 10.6 32.2 32.2 19.4 19.4 28.1 50th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Hold 30th %ile Green (s) 19.3 19.3 54.2 54.2 8.8 8.8 43.7 43.7 16.6 16.6 22.4 30th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Hold 10th %ile Green (s) 15.0 15.0 70.6 70.6 6.1 6.1 61.7 61.7 12.3 12.3 12.9 10th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Gap Queue Length 50th (ft) 183 479 61 70 161 0 167 137 Queue Length 95th (ft) #324 #616 144 126 202 0 239 188 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 275 1942 706 148 1561 631 377 750 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 0.82 0.83 0.38 0.57 0.39 0.18 0.54 0.50 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2024 No Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 4 Lane Group SBU SBL SBT SBR Detector Phase 7 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 43.0 43.0 Total Split (s) 29.0 29.0 29.0 29.0 Total Split (%) 22.3% 22.3% 22.3% 22.3% Maximum Green (s) 22.0 22.0 22.0 22.0 Yellow Time (s) 4.0 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 Recall Mode None None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 18.5 23.0 23.0 Actuated g/C Ratio 0.14 0.18 0.18 v/c Ratio 0.82 0.45 0.92 Control Delay 78.5 49.7 40.3 Queue Delay 0.0 0.0 0.0 Total Delay 78.5 49.7 40.3 LOS E D D Approach Delay 50.8 Approach LOS D 90th %ile Green (s) 22.0 22.0 23.6 23.6 90th %ile Term Code Max Max Max Max 70th %ile Green (s) 22.0 22.0 27.7 27.7 70th %ile Term Code Max Max Max Max 50th %ile Green (s) 19.4 19.4 28.1 28.1 50th %ile Term Code Gap Gap Gap Gap 30th %ile Green (s) 16.6 16.6 22.4 22.4 30th %ile Term Code Gap Gap Gap Gap 10th %ile Green (s) 12.4 12.4 13.0 13.0 10th %ile Term Code Gap Gap Hold Hold Queue Length 50th (ft) 167 106 150 Queue Length 95th (ft) 249 157 #373 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 296 667 568 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.69 0.42 0.89 Intersection Summary Lanes, Volumes, Timings 2024 No Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 5 Cycle Length: 130 Actuated Cycle Length: 130 Offset: 5 (4%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 120 Control Type: Actuated-Coordinated Maximum v/c Ratio: 0.92 Intersection Signal Delay: 45.6 Intersection LOS: D Intersection Capacity Utilization 87.5% ICU Level of Service E Analysis Period (min) 15 # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2024 No Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 48 35 29 27 39 29 35 Maximum Split (%) 13.8% 36.9% 26.9% 22.3% 20.8% 30.0% 22.3% 26.9% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 76 94 12 47 76 103 12 41 End Time (s) 94 12 47 76 103 12 41 76 Yield/Force Off (s) 87 5 40 69 96 5 34 69 Yield/Force Off 170(s) 87 109 40 40 96 110 34 38 Local Start Time (s) 71 89 7 42 71 98 7 36 Local Yield (s) 82 0 35 64 91 0 29 64 Local Yield 170(s) 82 104 35 35 91 105 29 33 Intersection Summary Cycle Length 130 Control Type Actuated-Coordinated Natural Cycle 120 Offset: 5 (4%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2024 No Build AM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 1 Intersection Int Delay, s/veh 1.5 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 5 0 7 10 0 50 17 437 13 11 45 501 30 Future Vol, veh/h 5 0 7 10 0 50 17 437 13 11 45 501 30 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free RT Channelized - - None - - None - - None - - - None Storage Length - - 100 - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - 0 - - - 0 - Grade, % - 0 - - 0 - - 0 - - - 0 - Peak Hour Factor 83 83 83 83 83 83 83 83 83 92 83 83 83 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 6 0 8 12 0 60 20 527 16 12 54 604 36 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 1040 1319 302 1009 1347 272 640 0 0 542 543 0 0 Stage 1 736 736 - 575 575 - - - - - - - - Stage 2 304 583 - 434 772 - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 183 155 691 193 149 723 933 - - 647 1015 - - Stage 1 374 421 - 468 498 - - - - - - - - Stage 2 678 494 - 568 405 - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 156 141 691 177 135 723 933 - - 903 903 - - Mov Cap-2 Maneuver 156 141 - 177 135 - - - - - - - - Stage 1 366 390 - 458 488 - - - - - - - - Stage 2 608 484 - 520 375 - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 18.1 13.9 0.3 0.9 HCM LOS C B Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 933 - - 156 691 478 903 - - HCM Lane V/C Ratio 0.022 - - 0.039 0.012 0.151 0.073 - - HCM Control Delay (s) 8.9 - - 29 10.3 13.9 9.3 - - HCM Lane LOS A - - D B B A - - HCM 95th %tile Q(veh) 0.1 - - 0.1 0 0.5 0.2 - - HCM 6th TWSC 2024 No Build AM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 2 Intersection Int Delay, s/veh 6.9 Movement EBL EBR NBU NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 86 130 2 84 372 6 456 65 Future Vol, veh/h 86 130 2 84 372 6 456 65 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free Free RT Channelized - None - - None - - None Storage Length 100 0 - 160 - - - 110 Veh in Median Storage, # 0 - - - 0 - 0 - Grade, % 0 - - - 0 - 0 - Peak Hour Factor 73 73 92 73 73 92 73 73 Heavy Vehicles, % 3 3 3 3 3 3 3 3 Mvmt Flow 118 178 2 115 510 7 625 89 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 1128 313 625 714 0 510 - 0 Stage 1 639 - - - - - - - Stage 2 489 - - - - - - - Critical Hdwy 6.86 6.96 6.46 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - - Follow-up Hdwy 3.53 3.33 2.53 2.23 - 2.53 - - Pot Cap-1 Maneuver 196 680 573 875 - 678 - - Stage 1 485 - - - - - - - Stage 2 579 - - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 166 680 861 861 - 678 - - Mov Cap-2 Maneuver 166 - - - - - - - Stage 1 419 - - - - - - - Stage 2 569 - - - - - - - Approach EB NB SB HCM Control Delay, s 34.1 1.8 0.1 HCM LOS D Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 861 - 166 680 - - HCM Lane V/C Ratio 0.136 - 0.71 0.262 - - HCM Control Delay (s) 9.8 - 67.2 12.2 - - HCM Lane LOS A - F B - - HCM 95th %tile Q(veh) 0.5 - 4.3 1 - - HCM 6th TWSC 2024 No Build AM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 3 Intersection Int Delay, s/veh 2.4 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 3 14 1990 134 4 34 1214 14 8 0 22 6 0 14 Future Vol, veh/h 3 14 1990 134 4 34 1214 14 8 0 22 6 0 14 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - None Storage Length - 345 - 180 - 200 - - - - 100 - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - 0 - Grade, % - - 0 - - - 0 - - 0 - - 0 - Peak Hour Factor 92 95 95 95 92 95 95 95 95 95 95 95 95 95 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 5 3 3 3 Mvmt Flow 3 15 2095 141 4 36 1278 15 8 0 23 6 0 15 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 944 1293 0 0 1529 2236 0 0 2722 3504 1048 2240 3638 647 Stage 1 - - - - - - - - 2131 2131 - 1366 1366 - Stage 2 - - - - - - - - 591 1373 - 874 2272 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.2 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.95 3.83 4.03 3.93 Pot Cap-1 Maneuver 468 279 - - 220 93 - - 22 6 189 44 5 353 Stage 1 - - - - - - - - 30 87 - 109 211 - Stage 2 - - - - - - - - 417 210 - 280 74 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 300 300 - - 99 99 - - 14 3 189 25 3 353 Mov Cap-2 Maneuver - - - - - - - - 14 3 - 25 3 - Stage 1 - - - - - - - - 28 82 - 102 125 - Stage 2 - - - - - - - - 237 125 - 231 70 - Approach EB WB NB SB HCM Control Delay, s 0.1 1.9 139.9 68.6 HCM LOS F F Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) 14 189 300 - - 99 - - 25 353 HCM Lane V/C Ratio 0.602 0.123 0.06 - - 0.405 - - 0.253 0.042 HCM Control Delay (s) $ 451.1 26.7 17.8 - - 64.6 - - 192.1 15.6 HCM Lane LOS F D C - - F - - F C HCM 95th %tile Q(veh) 1.5 0.4 0.2 - - 1.7 - - 0.8 0.1 HCM 6th TWSC 2024 No Build AM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 4 Intersection Int Delay, s/veh 10.9 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 1 1 118 141 1 0 34 0 212 0 0 0 Future Vol, veh/h 1 1 118 141 1 0 34 0 212 0 0 0 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 53 53 53 53 53 53 53 53 53 53 53 53 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 2 2 223 266 2 0 64 0 400 0 0 0 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 2 0 0 225 0 0 652 652 114 852 763 2 Stage 1 - - - - - - 118 118 - 534 534 - Stage 2 - - - - - - 534 534 - 318 229 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1614 - - 1338 - - 380 386 936 278 333 1079 Stage 1 - - - - - - 884 796 - 528 523 - Stage 2 - - - - - - 528 523 - 691 713 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1614 - - 1338 - - 321 309 936 135 266 1079 Mov Cap-2 Maneuver - - - - - - 321 309 - 135 266 - Stage 1 - - - - - - 883 795 - 527 419 - Stage 2 - - - - - - 423 419 - 395 712 - Approach EB WB NB SB HCM Control Delay, s 0.1 8.3 17.7 0 HCM LOS C A Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 740 1614 - - 1338 - - - HCM Lane V/C Ratio 0.627 0.001 - - 0.199 - - - HCM Control Delay (s) 17.7 7.2 - - 8.4 - - 0 HCM Lane LOS C A - - A - - A HCM 95th %tile Q(veh) 4.5 0 - - 0.7 - - - Lanes, Volumes, Timings 2024 No Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU Lane Configurations Traffic Volume (vph) 9 243 1209 183 2 97 1207 257 235 239 100 2 Future Volume (vph) 9 243 1209 183 2 97 1207 257 235 239 100 2 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 1.00 0.95 0.95 0.95 Frt 0.850 0.850 0.956 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 1752 3351 0 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 1752 3351 0 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 138 182 39 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 Adj. Flow (vph) 9 256 1273 193 2 102 1271 271 247 252 105 2 Shared Lane Traffic (%) Lane Group Flow (vph) 0 265 1273 193 0 104 1271 271 247 357 0 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right Left R NA Right R NA Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 15 9 9 Number of Detectors 1 1 2 1 1 1 2 1 1 2 1 Detector Template Left Left Thru Right Left Left Thru Right Left Thru Left Leading Detector (ft) 20 20 100 20 20 20 100 20 20 100 20 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot NA Prot Protected Phases 5 5 2 1 1 6 3 8 7 Permitted Phases 2 6 Lanes, Volumes, Timings 2024 No Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 2 Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 145 250 475 Future Volume (vph) 145 250 475 Ideal Flow (vphpl) 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 254 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.95 0.95 0.95 Adj. Flow (vph) 153 263 500 Shared Lane Traffic (%) Lane Group Flow (vph) 155 263 500 Enter Blocked Intersection No No No Lane Alignment Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 Turning Speed (mph) 15 9 Number of Detectors 1 2 1 Detector Template Left Thru Right Leading Detector (ft) 20 100 20 Trailing Detector (ft) 0 0 0 Detector 1 Position(ft) 0 0 0 Detector 1 Size(ft) 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot NA Perm Protected Phases 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2024 No Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU Detector Phase 5 5 2 2 1 1 6 6 3 8 7 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 45.0 12.0 Total Split (s) 31.0 31.0 60.0 60.0 18.0 18.0 47.0 47.0 30.0 41.0 31.0 Total Split (%) 20.7% 20.7% 40.0% 40.0% 12.0% 12.0% 31.3% 31.3% 20.0% 27.3% 20.7% Maximum Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 34.0 24.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lag Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 24.4 57.9 57.9 10.8 44.3 44.3 22.4 35.7 Actuated g/C Ratio 0.16 0.39 0.39 0.07 0.30 0.30 0.15 0.24 v/c Ratio 0.93 0.66 0.28 0.83 0.85 0.46 0.95 0.43 Control Delay 99.5 40.9 11.7 111.1 57.2 17.7 106.0 44.4 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 99.5 40.9 11.7 111.1 57.2 17.7 106.0 44.4 LOS F D B F E B F D Approach Delay 46.6 54.1 69.6 Approach LOS D D E 90th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 34.0 24.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Max 70th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 37.7 20.3 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 50th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 40.4 17.6 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 30th %ile Green (s) 27.5 27.5 57.2 57.2 12.2 12.2 41.9 41.9 23.0 37.7 14.9 30th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Max Hold Gap 10th %ile Green (s) 22.5 22.5 73.3 73.3 9.0 9.0 59.8 59.8 20.2 28.7 11.0 10th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Hold Gap Queue Length 50th (ft) 260 394 36 102 449 69 242 132 Queue Length 95th (ft) #438 451 98 #208 #542 161 #413 191 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 288 1943 690 131 1488 591 268 850 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 0.92 0.66 0.28 0.79 0.85 0.46 0.92 0.42 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2024 No Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 4 Lane Group SBL SBT SBR Detector Phase 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 12.0 43.0 43.0 Total Split (s) 31.0 42.0 42.0 Total Split (%) 20.7% 28.0% 28.0% Maximum Green (s) 24.0 35.0 35.0 Yellow Time (s) 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 Recall Mode None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 17.6 30.8 30.8 Actuated g/C Ratio 0.12 0.21 0.21 v/c Ratio 0.76 0.37 0.96 Control Delay 86.0 51.8 57.8 Queue Delay 0.0 0.0 0.0 Total Delay 86.0 51.8 57.8 LOS F D E Approach Delay 60.8 Approach LOS E 90th %ile Green (s) 24.0 35.0 35.0 90th %ile Term Code Max Max Max 70th %ile Green (s) 20.3 35.0 35.0 70th %ile Term Code Gap Max Max 50th %ile Green (s) 17.6 35.0 35.0 50th %ile Term Code Gap Max Max 30th %ile Green (s) 14.9 29.6 29.6 30th %ile Term Code Gap Gap Gap 10th %ile Green (s) 11.0 19.5 19.5 10th %ile Term Code Gap Gap Gap Queue Length 50th (ft) 149 113 258 Queue Length 95th (ft) 221 157 #471 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 280 817 560 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.55 0.32 0.89 Intersection Summary Lanes, Volumes, Timings 2024 No Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 5 Cycle Length: 150 Actuated Cycle Length: 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 130 Control Type: Actuated-Coordinated Maximum v/c Ratio: 0.96 Intersection Signal Delay: 54.6 Intersection LOS: D Intersection Capacity Utilization 103.0% ICU Level of Service G Analysis Period (min) 15 # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2024 No Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 60 30 42 31 47 31 41 Maximum Split (%) 12.0% 40.0% 20.0% 28.0% 20.7% 31.3% 20.7% 27.3% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 84 102 12 42 84 115 12 43 End Time (s) 102 12 42 84 115 12 43 84 Yield/Force Off (s) 95 5 35 77 108 5 36 77 Yield/Force Off 170(s) 95 129 35 48 108 130 36 46 Local Start Time (s) 79 97 7 37 79 110 7 38 Local Yield (s) 90 0 30 72 103 0 31 72 Local Yield 170(s) 90 124 30 43 103 125 31 41 Intersection Summary Cycle Length 150 Control Type Actuated-Coordinated Natural Cycle 130 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2024 No Build School PM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 1 Intersection Int Delay, s/veh 9.6 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 110 0 60 3 0 27 41 413 8 23 22 385 111 Future Vol, veh/h 110 0 60 3 0 27 41 413 8 23 22 385 111 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free RT Channelized - - None - - None - - None - - - None Storage Length - - 100 - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - 0 - - - 0 - Grade, % - 0 - - 0 - - 0 - - - 0 - Peak Hour Factor 76 76 76 76 76 76 76 76 76 92 76 76 76 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 145 0 79 4 0 36 54 543 11 25 29 507 146 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 995 1277 254 1019 1418 277 653 0 0 554 554 0 0 Stage 1 615 615 - 657 657 - - - - - - - - Stage 2 380 662 - 362 761 - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 198 164 742 190 135 717 923 - - 636 1005 - - Stage 1 443 478 - 418 457 - - - - - - - - Stage 2 611 455 - 626 410 - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 170 144 742 154 118 717 923 - - 775 775 - - Mov Cap-2 Maneuver 170 144 - 154 118 - - - - - - - - Stage 1 417 445 - 393 430 - - - - - - - - Stage 2 547 428 - 520 381 - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 61.1 12.4 0.8 0.8 HCM LOS F B Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 923 - - 170 742 525 775 - - HCM Lane V/C Ratio 0.058 - - 0.851 0.106 0.075 0.07 - - HCM Control Delay (s) 9.1 - - 88.8 10.4 12.4 10 - - HCM Lane LOS A - - F B B A - - HCM 95th %tile Q(veh) 0.2 - - 6 0.4 0.2 0.2 - - HCM 6th TWSC 2024 No Build School PM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 2 Intersection Int Delay, s/veh 3.7 Movement EBL EBR NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 62 68 50 395 6 392 45 Future Vol, veh/h 62 68 50 395 6 392 45 Conflicting Peds, #/hr 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free RT Channelized - None - None - - None Storage Length 100 0 160 - - - 110 Veh in Median Storage, # 0 - - 0 - 0 - Grade, % 0 - - 0 - 0 - Peak Hour Factor 65 65 65 65 92 65 65 Heavy Vehicles, % 3 3 3 3 3 3 3 Mvmt Flow 95 105 77 608 7 603 69 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 1075 302 672 0 608 - 0 Stage 1 617 - - - - - - Stage 2 458 - - - - - - Critical Hdwy 6.86 6.96 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - Follow-up Hdwy 3.53 3.33 2.23 - 2.53 - - Pot Cap-1 Maneuver 213 691 908 - 587 - - Stage 1 498 - - - - - - Stage 2 601 - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 191 691 908 - 587 - - Mov Cap-2 Maneuver 191 - - - - - - Stage 1 456 - - - - - - Stage 2 590 - - - - - - Approach EB NB SB HCM Control Delay, s 25.5 1 0.1 HCM LOS D Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 908 - 191 691 - - HCM Lane V/C Ratio 0.085 - 0.499 0.151 - - HCM Control Delay (s) 9.3 - 41.3 11.1 - - HCM Lane LOS A - E B - - HCM 95th %tile Q(veh) 0.3 - 2.5 0.5 - - HCM 6th TWSC 2024 No Build School PM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 3 Intersection Int Delay, s/veh 1.5 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 15 45 1484 161 5 56 1853 49 30 3 122 3 1 3 75 Future Vol, veh/h 15 45 1484 161 5 56 1853 49 30 3 122 3 1 3 75 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - - None Storage Length - 345 - 180 - 200 - - - - 100 - - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - - 0 - Grade, % - - 0 - - - 0 - - 0 - - - 0 - Peak Hour Factor 92 95 95 95 92 95 95 95 95 95 95 92 95 95 95 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 16 47 1562 169 5 59 1951 52 32 3 128 3 1 3 79 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1462 2003 0 0 1140 1731 0 0 2598 3819 781 0 2857 3962 1002 Stage 1 - - - - - - - - 1688 1688 - 0 2105 2105 - Stage 2 - - - - - - - - 910 2131 - 0 752 1857 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.16 - 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.93 - 3.83 4.03 3.93 Pot Cap-1 Maneuver 240 123 - - 364 169 - - ~ 26 4 288 0 18 ~ 3 205 Stage 1 - - - - - - - - 64 147 - 0 32 90 - Stage 2 - - - - - - - - 266 87 - 0 333 121 - Platoon blocked, % - - - - - Mov Cap-1 Maneuver 129 129 - - 172 172 - - - ~ 1 288 0 - ~ 1 205 Mov Cap-2 Maneuver - - - - - - - - - ~ 1 - 0 - ~ 1 - Stage 1 - - - - - - - - 32 74 - 0 16 57 - Stage 2 - - - - - - - - 97 55 - 0 89 61 - Approach EB WB NB SB HCM Control Delay, s 2 1.2 HCM LOS - - Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) - 288 129 - - 172 - - - 205 HCM Lane V/C Ratio - 0.446 0.494 - - 0.374 - - - 0.385 HCM Control Delay (s) - 27.2 57.2 - - 38 - - - 33.2 HCM Lane LOS - D F - - E - - - D HCM 95th %tile Q(veh) - 2.2 2.3 - - 1.6 - - - 1.7 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2024 No Build School PM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 4 Intersection Int Delay, s/veh 8.3 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 1 12 28 70 10 12 9 2 96 20 0 6 Future Vol, veh/h 1 12 28 70 10 12 9 2 96 20 0 6 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 39 39 39 39 39 39 39 39 39 39 39 39 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 3 31 72 179 26 31 23 5 246 51 0 15 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 57 0 0 103 0 0 480 488 67 599 509 42 Stage 1 - - - - - - 73 73 - 400 400 - Stage 2 - - - - - - 407 415 - 199 109 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1541 - - 1483 - - 494 479 994 412 466 1026 Stage 1 - - - - - - 934 832 - 624 600 - Stage 2 - - - - - - 619 591 - 801 803 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1541 - - 1483 - - 441 420 994 279 409 1026 Mov Cap-2 Maneuver - - - - - - 441 420 - 279 409 - Stage 1 - - - - - - 932 830 - 623 527 - Stage 2 - - - - - - 536 519 - 598 801 - Approach EB WB NB SB HCM Control Delay, s 0.2 5.9 10.9 18.4 HCM LOS B C Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 879 1541 - - 1483 - - 335 HCM Lane V/C Ratio 0.312 0.002 - - 0.121 - - 0.199 HCM Control Delay (s) 10.9 7.3 - - 7.8 - - 18.4 HCM Lane LOS B A - - A - - C HCM 95th %tile Q(veh) 1.3 0 - - 0.4 - - 0.7 Lanes, Volumes, Timings 2024 No Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 6 275 1421 104 3 118 1523 303 2 258 389 102 Future Volume (vph) 6 275 1421 104 3 118 1523 303 2 258 389 102 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 0.95 1.00 0.95 0.95 Frt 0.850 0.850 0.969 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3396 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3396 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 131 182 20 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Adj. Flow (vph) 6 286 1480 108 3 123 1586 316 2 269 405 106 Shared Lane Traffic (%) Lane Group Flow (vph) 0 292 1480 108 0 126 1586 316 0 271 511 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right R NA Left R NA Right Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 9 15 9 Number of Detectors 1 1 2 1 1 1 2 1 1 1 2 Detector Template Left Left Thru Right Left Left Thru Right Left Left Thru Leading Detector (ft) 20 20 100 20 20 20 100 20 20 20 100 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 20 6 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases 2 6 Lanes, Volumes, Timings 2024 No Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 2 Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 160 231 539 Future Volume (vph) 160 231 539 Ideal Flow (vphpl) 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 252 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.96 0.96 0.96 Adj. Flow (vph) 167 241 561 Shared Lane Traffic (%) Lane Group Flow (vph) 167 241 561 Enter Blocked Intersection No No No Lane Alignment Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 Turning Speed (mph) 15 9 Number of Detectors 1 2 1 Detector Template Left Thru Right Leading Detector (ft) 20 100 20 Trailing Detector (ft) 0 0 0 Detector 1 Position(ft) 0 0 0 Detector 1 Size(ft) 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot NA Perm Protected Phases 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2024 No Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Detector Phase 5 5 2 2 1 1 6 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 12.0 45.0 Total Split (s) 31.0 31.0 60.0 60.0 18.0 18.0 47.0 47.0 30.0 30.0 41.0 Total Split (%) 20.7% 20.7% 40.0% 40.0% 12.0% 12.0% 31.3% 31.3% 20.0% 20.0% 27.3% Maximum Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 34.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lead Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 24.0 53.0 53.0 11.0 40.0 40.0 23.0 39.7 Actuated g/C Ratio 0.16 0.35 0.35 0.07 0.27 0.27 0.15 0.26 v/c Ratio 1.04 0.83 0.17 0.98 1.18 0.57 1.01 0.56 Control Delay 124.7 49.5 3.3 143.0 136.9 24.0 119.5 49.3 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 124.7 49.5 3.3 143.0 136.9 24.0 119.5 49.3 LOS F D A F F C F D Approach Delay 58.5 119.7 73.6 Approach LOS E F E 90th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 34.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 70th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 36.6 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 50th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 39.4 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 30th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 42.2 30th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 10th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 46.3 10th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold Queue Length 50th (ft) ~308 484 0 125 ~679 112 ~272 220 Queue Length 95th (ft) #501 548 27 #263 #776 216 #466 296 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 280 1779 638 128 1342 551 268 913 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 1.04 0.83 0.17 0.98 1.18 0.57 1.01 0.56 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2024 No Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 4 Lane Group SBL SBT SBR Detector Phase 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 12.0 43.0 43.0 Total Split (s) 31.0 42.0 42.0 Total Split (%) 20.7% 28.0% 28.0% Maximum Green (s) 24.0 35.0 35.0 Yellow Time (s) 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 Recall Mode None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 18.3 35.0 35.0 Actuated g/C Ratio 0.12 0.23 0.23 v/c Ratio 0.78 0.29 1.00 Control Delay 87.7 48.5 70.0 Queue Delay 0.0 0.0 0.0 Total Delay 87.7 48.5 70.0 LOS F D E Approach Delay 67.7 Approach LOS E 90th %ile Green (s) 24.0 35.0 35.0 90th %ile Term Code Max Max Max 70th %ile Green (s) 21.4 35.0 35.0 70th %ile Term Code Gap Max Max 50th %ile Green (s) 18.6 35.0 35.0 50th %ile Term Code Gap Max Max 30th %ile Green (s) 15.8 35.0 35.0 30th %ile Term Code Gap Max Max 10th %ile Green (s) 11.7 35.0 35.0 10th %ile Term Code Gap Max Max Queue Length 50th (ft) 161 103 ~351 Queue Length 95th (ft) 236 144 #608 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 280 817 559 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.60 0.29 1.00 Intersection Summary Lanes, Volumes, Timings 2024 No Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 5 Cycle Length: 150 Actuated Cycle Length: 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 150 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.18 Intersection Signal Delay: 84.1 Intersection LOS: F Intersection Capacity Utilization 116.1% ICU Level of Service H Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2024 No Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 60 30 42 31 47 31 41 Maximum Split (%) 12.0% 40.0% 20.0% 28.0% 20.7% 31.3% 20.7% 27.3% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 84 102 12 42 84 115 12 43 End Time (s) 102 12 42 84 115 12 43 84 Yield/Force Off (s) 95 5 35 77 108 5 36 77 Yield/Force Off 170(s) 95 129 35 48 108 130 36 46 Local Start Time (s) 79 97 7 37 79 110 7 38 Local Yield (s) 90 0 30 72 103 0 31 72 Local Yield 170(s) 90 124 30 43 103 125 31 41 Intersection Summary Cycle Length 150 Control Type Actuated-Coordinated Natural Cycle 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2024 No Build Commuter PM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 1 Intersection Int Delay, s/veh 4.7 Movement EBL EBT EBR WBL WBT WBR NBU NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 85 0 44 16 0 57 3 49 534 16 13 49 324 88 Future Vol, veh/h 85 0 44 16 0 57 3 49 534 16 13 49 324 88 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free Free RT Channelized - - None - - None - - - None - - - None Storage Length - - 100 - - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - - 0 - - - 0 - Grade, % - 0 - - 0 - - - 0 - - - 0 - Peak Hour Factor 92 92 92 92 92 92 92 92 92 92 92 92 92 92 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 92 0 48 17 0 62 3 53 580 17 14 53 352 96 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 888 1195 176 1011 1283 299 352 448 0 0 598 597 0 0 Stage 1 486 486 - 701 701 - - - - - - - - - Stage 2 402 709 - 310 582 - - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 6.46 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.53 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 237 184 834 192 162 694 854 1102 - - 596 969 - - Stage 1 529 547 - 393 437 - - - - - - - - - Stage 2 593 433 - 672 495 - - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 195 160 834 163 141 694 1079 1079 - - 834 834 - - Mov Cap-2 Maneuver 195 160 - 163 141 - - - - - - - - - Stage 1 501 503 - 372 414 - - - - - - - - - Stage 2 512 410 - 583 455 - - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 29 16 0.7 1.3 HCM LOS D C Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 1079 - - 195 834 405 834 - - HCM Lane V/C Ratio 0.052 - - 0.474 0.057 0.196 0.081 - - HCM Control Delay (s) 8.5 - - 39.1 9.6 16 9.7 - - HCM Lane LOS A - - E A C A - - HCM 95th %tile Q(veh) 0.2 - - 2.3 0.2 0.7 0.3 - - HCM 6th TWSC 2024 No Build Commuter PM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 2 Intersection Int Delay, s/veh 0.4 Movement EBL EBR NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 9 5 8 571 9 374 2 Future Vol, veh/h 9 5 8 571 9 374 2 Conflicting Peds, #/hr 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free RT Channelized - None - None - - None Storage Length 100 0 160 - - - 110 Veh in Median Storage, # 0 - - 0 - 0 - Grade, % 0 - - 0 - 0 - Peak Hour Factor 83 83 83 83 92 83 83 Heavy Vehicles, % 3 3 3 3 3 3 3 Mvmt Flow 11 6 10 688 10 451 2 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 835 226 453 0 688 - 0 Stage 1 471 - - - - - - Stage 2 364 - - - - - - Critical Hdwy 6.86 6.96 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - Follow-up Hdwy 3.53 3.33 2.23 - 2.53 - - Pot Cap-1 Maneuver 304 774 1097 - 522 - - Stage 1 592 - - - - - - Stage 2 671 - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 293 774 1097 - 522 - - Mov Cap-2 Maneuver 293 - - - - - - Stage 1 587 - - - - - - Stage 2 654 - - - - - - Approach EB NB SB HCM Control Delay, s 14.9 0.1 0.3 HCM LOS B Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 1097 - 293 774 - - HCM Lane V/C Ratio 0.009 - 0.037 0.008 - - HCM Control Delay (s) 8.3 - 17.8 9.7 - - HCM Lane LOS A - C A - - HCM 95th %tile Q(veh) 0 - 0.1 0 - - HCM 6th TWSC 2024 No Build Commuter PM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 3 Intersection Int Delay, s/veh 23.9 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 13 41 1540 102 1 61 2213 45 16 4 122 6 2 2 65 Future Vol, veh/h 13 41 1540 102 1 61 2213 45 16 4 122 6 2 2 65 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - - None Storage Length - 345 - 180 - 200 - - - - 100 - - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - - 0 - Grade, % - - 0 - - - 0 - - 0 - - - 0 - Peak Hour Factor 92 96 96 96 92 96 96 96 96 96 96 92 96 96 96 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 14 43 1604 106 1 64 2305 47 17 4 127 7 2 2 68 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1717 2352 0 0 1171 1710 0 0 2771 4200 802 0 3217 4283 1176 Stage 1 - - - - - - - - 1718 1718 - 0 2459 2459 - Stage 2 - - - - - - - - 1053 2482 - 0 758 1824 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.16 - 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.93 - 3.83 4.03 3.93 Pot Cap-1 Maneuver 172 81 - - 350 173 - - 20 ~ 2 279 0 10 ~ 2 157 Stage 1 - - - - - - - - 61 142 - 0 17 59 - Stage 2 - - - - - - - - 216 57 - 0 330 125 - Platoon blocked, % - - - - - Mov Cap-1 Maneuver 85 85 - - 173 173 - - ~ 4 0 279 0 ~ 2 0 157 Mov Cap-2 Maneuver - - - - - - - - ~ 4 0 - 0 ~ 2 0 - Stage 1 - - - - - - - - 20 47 - 0 6 37 - Stage 2 - - - - - - - - 72 36 - 0 54 41 - Approach EB WB NB SB HCM Control Delay, s 3.5 1 $ 529.3 237.1 HCM LOS F F Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) 4 279 85 - - 173 - - 2 157 HCM Lane V/C Ratio 5.208 0.455 0.669 - - 0.374 - - 2.083 0.431 HCM Control Delay (s) $ 3585.6 28.3 107.6 - - 37.6 - -$ 3370.5 44.3 HCM Lane LOS F D F - - E - - F E HCM 95th %tile Q(veh) 4 2.2 3.2 - - 1.6 - - 1.4 1.9 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2024 No Build Commuter PM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 4 Intersection Int Delay, s/veh 2.5 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 0 7 0 1 7 2 0 0 6 0 0 0 Future Vol, veh/h 0 7 0 1 7 2 0 0 6 0 0 0 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 82 82 82 82 82 82 82 82 82 82 82 82 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 0 9 0 1 9 2 0 0 7 0 0 0 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 11 0 0 9 0 0 21 22 9 25 21 10 Stage 1 - - - - - - 9 9 - 12 12 - Stage 2 - - - - - - 12 13 - 13 9 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1602 - - 1604 - - 989 870 1070 983 871 1068 Stage 1 - - - - - - 1010 886 - 1006 884 - Stage 2 - - - - - - 1006 883 - 1005 886 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1602 - - 1604 - - 989 869 1070 976 870 1068 Mov Cap-2 Maneuver - - - - - - 989 869 - 976 870 - Stage 1 - - - - - - 1010 886 - 1006 883 - Stage 2 - - - - - - 1005 882 - 998 886 - Approach EB WB NB SB HCM Control Delay, s 0 0.7 8.4 0 HCM LOS A A Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 1070 1602 - - 1604 - - - HCM Lane V/C Ratio 0.007 - - - 0.001 - - - HCM Control Delay (s) 8.4 0 - - 7.2 - - 0 HCM Lane LOS A A - - A - - A HCM 95th %tile Q(veh) 0 0 - - 0 - - - Lanes, Volumes, Timings 2029 (No Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 2 238 1701 284 8 82 645 123 1 214 314 80 Future Volume (vph) 2 238 1701 284 8 82 645 123 1 214 314 80 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 0.95 1.00 0.95 0.95 Frt 0.850 0.850 0.970 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3400 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3400 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 166 210 22 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Adj. Flow (vph) 2 248 1772 296 8 85 672 128 1 223 327 83 Shared Lane Traffic (%) Lane Group Flow (vph) 0 250 1772 296 0 93 672 128 0 224 410 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right R NA Left R NA Right Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 9 15 9 Number of Detectors 1 1 2 1 1 1 2 1 1 1 2 Detector Template Left Left Thru Right Left Left Thru Right Left Left Thru Leading Detector (ft) 20 20 100 20 20 20 100 20 20 20 100 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 20 6 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases 2 6 Lanes, Volumes, Timings 2029 (No Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 2 Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 1 214 298 536 Future Volume (vph) 1 214 298 536 Ideal Flow (vphpl) 1900 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 0.95 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 0 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 0 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 314 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.96 0.96 0.96 0.96 Adj. Flow (vph) 1 223 310 558 Shared Lane Traffic (%) Lane Group Flow (vph) 0 224 310 558 Enter Blocked Intersection No No No No Lane Alignment R NA Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 Number of Detectors 1 1 2 1 Detector Template Left Left Thru Right Leading Detector (ft) 20 20 100 20 Trailing Detector (ft) 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot Prot NA Perm Protected Phases 7 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2029 (No Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Detector Phase 5 5 2 2 1 1 6 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 12.0 45.0 Total Split (s) 27.0 27.0 48.0 48.0 18.0 18.0 39.0 39.0 35.0 35.0 35.0 Total Split (%) 20.8% 20.8% 36.9% 36.9% 13.8% 13.8% 30.0% 30.0% 26.9% 26.9% 26.9% Maximum Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 28.0 28.0 28.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lead Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 19.7 42.2 42.2 9.8 32.3 32.3 20.9 30.4 Actuated g/C Ratio 0.15 0.32 0.32 0.08 0.25 0.25 0.16 0.23 v/c Ratio 0.94 1.09 0.48 0.70 0.54 0.23 0.80 0.50 Control Delay 97.4 90.9 17.9 85.4 44.3 1.0 72.3 44.0 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 97.4 90.9 17.9 85.4 44.3 1.0 72.3 44.0 LOS F F B F D A E D Approach Delay 82.2 42.4 54.0 Approach LOS F D D 90th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 28.0 28.0 28.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 70th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 23.9 23.9 28.0 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Gap Gap Hold 50th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 21.0 21.0 28.6 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Gap Gap Hold 30th %ile Green (s) 20.0 20.0 42.5 42.5 9.5 9.5 32.0 32.0 18.0 18.0 31.6 30th %ile Term Code Max Max Coord Coord Gap Gap Coord Coord Gap Gap Hold 10th %ile Green (s) 18.4 18.4 45.3 45.3 6.7 6.7 33.6 33.6 13.5 13.5 36.0 10th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Hold Queue Length 50th (ft) 211 ~627 84 77 181 0 184 153 Queue Length 95th (ft) #373 #723 173 #147 224 0 260 208 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 269 1633 620 148 1251 547 377 813 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 0.93 1.09 0.48 0.63 0.54 0.23 0.59 0.50 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2029 (No Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 4 Lane Group SBU SBL SBT SBR Detector Phase 7 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 43.0 43.0 Total Split (s) 29.0 29.0 29.0 29.0 Total Split (%) 22.3% 22.3% 22.3% 22.3% Maximum Green (s) 22.0 22.0 22.0 22.0 Yellow Time (s) 4.0 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 Recall Mode None None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 19.6 29.1 29.1 Actuated g/C Ratio 0.15 0.22 0.22 v/c Ratio 0.85 0.39 0.94 Control Delay 81.3 46.0 46.8 Queue Delay 0.0 0.0 0.0 Total Delay 81.3 46.0 46.8 LOS F D D Approach Delay 53.7 Approach LOS D 90th %ile Green (s) 22.0 22.0 22.0 22.0 90th %ile Term Code Max Max Max Max 70th %ile Green (s) 22.0 22.0 26.1 26.1 70th %ile Term Code Max Max Max Max 50th %ile Green (s) 21.4 21.4 29.0 29.0 50th %ile Term Code Gap Gap Max Max 30th %ile Green (s) 18.4 18.4 32.0 32.0 30th %ile Term Code Gap Gap Max Max 10th %ile Green (s) 14.0 14.0 36.5 36.5 10th %ile Term Code Gap Gap Max Max Queue Length 50th (ft) 183 117 230 Queue Length 95th (ft) #299 175 #509 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 296 785 594 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.76 0.39 0.94 Intersection Summary Lanes, Volumes, Timings 2029 (No Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 5 Cycle Length: 130 Actuated Cycle Length: 130 Offset: 5 (4%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 140 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.09 Intersection Signal Delay: 65.1 Intersection LOS: E Intersection Capacity Utilization 94.2% ICU Level of Service F Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2029 (No Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 48 35 29 27 39 29 35 Maximum Split (%) 13.8% 36.9% 26.9% 22.3% 20.8% 30.0% 22.3% 26.9% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 76 94 12 47 76 103 12 41 End Time (s) 94 12 47 76 103 12 41 76 Yield/Force Off (s) 87 5 40 69 96 5 34 69 Yield/Force Off 170(s) 87 109 40 40 96 110 34 38 Local Start Time (s) 71 89 7 42 71 98 7 36 Local Yield (s) 82 0 35 64 91 0 29 64 Local Yield 170(s) 82 104 35 35 91 105 29 33 Intersection Summary Cycle Length 130 Control Type Actuated-Coordinated Natural Cycle 140 Offset: 5 (4%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2029 (No Build + 5 Years) AM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 1 Intersection Int Delay, s/veh 1.6 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 6 0 8 11 0 55 19 482 15 12 50 553 33 Future Vol, veh/h 6 0 8 11 0 55 19 482 15 12 50 553 33 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free RT Channelized - - None - - None - - None - - - None Storage Length - - 100 - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - 0 - - - 0 - Grade, % - 0 - - 0 - - 0 - - - 0 - Peak Hour Factor 83 83 83 83 83 83 83 83 83 92 83 83 83 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 7 0 10 13 0 66 23 581 18 13 60 666 40 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 1149 1457 333 1115 1488 300 706 0 0 599 599 0 0 Stage 1 812 812 - 636 636 - - - - - - - - Stage 2 337 645 - 479 852 - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 152 127 660 161 122 693 881 - - 595 967 - - Stage 1 337 388 - 430 468 - - - - - - - - Stage 2 648 463 - 534 372 - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 126 113 660 145 109 693 881 - - 851 851 - - Mov Cap-2 Maneuver 126 113 - 145 109 - - - - - - - - Stage 1 328 355 - 419 456 - - - - - - - - Stage 2 571 451 - 481 340 - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 21.1 15.4 0.3 0.9 HCM LOS C C Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 881 - - 126 660 425 851 - - HCM Lane V/C Ratio 0.026 - - 0.057 0.015 0.187 0.086 - - HCM Control Delay (s) 9.2 - - 35.3 10.5 15.4 9.6 - - HCM Lane LOS A - - E B C A - - HCM 95th %tile Q(veh) 0.1 - - 0.2 0 0.7 0.3 - - HCM 6th TWSC 2029 (No Build + 5 Years) AM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 2 Intersection Int Delay, s/veh 11.4 Movement EBL EBR NBU NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 95 143 2 92 411 7 503 72 Future Vol, veh/h 95 143 2 92 411 7 503 72 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free Free RT Channelized - None - - None - - None Storage Length 100 0 - 160 - - - 110 Veh in Median Storage, # 0 - - - 0 - 0 - Grade, % 0 - - - 0 - 0 - Peak Hour Factor 73 73 92 73 73 92 73 73 Heavy Vehicles, % 3 3 3 3 3 3 3 3 Mvmt Flow 130 196 2 126 563 8 689 99 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 1243 345 689 788 0 563 - 0 Stage 1 705 - - - - - - - Stage 2 538 - - - - - - - Critical Hdwy 6.86 6.96 6.46 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - - Follow-up Hdwy 3.53 3.33 2.53 2.23 - 2.53 - - Pot Cap-1 Maneuver 165 648 521 821 - 627 - - Stage 1 448 - - - - - - - Stage 2 547 - - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 136 648 807 807 - 627 - - Mov Cap-2 Maneuver 136 - - - - - - - Stage 1 377 - - - - - - - Stage 2 534 - - - - - - - Approach EB NB SB HCM Control Delay, s 59.2 1.9 0.1 HCM LOS F Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 807 - 136 648 - - HCM Lane V/C Ratio 0.159 - 0.957 0.302 - - HCM Control Delay (s) 10.3 - 129 12.9 - - HCM Lane LOS B - F B - - HCM 95th %tile Q(veh) 0.6 - 6.6 1.3 - - HCM 6th TWSC 2029 (No Build + 5 Years) AM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 3 Intersection Int Delay, s/veh 5.1 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 3 16 2197 148 5 37 1340 16 9 0 25 7 0 16 Future Vol, veh/h 3 16 2197 148 5 37 1340 16 9 0 25 7 0 16 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - None Storage Length - 345 - 180 - 200 - - - - 100 - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - 0 - Grade, % - - 0 - - - 0 - - 0 - - 0 - Peak Hour Factor 92 95 95 95 92 95 95 95 95 95 95 95 95 95 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 5 3 3 3 Mvmt Flow 3 17 2313 156 5 39 1411 17 9 0 26 7 0 17 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1042 1428 0 0 1688 2469 0 0 3005 3869 1157 2473 4017 714 Stage 1 - - - - - - - - 2353 2353 - 1508 1508 - Stage 2 - - - - - - - - 652 1516 - 965 2509 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.2 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.95 3.83 4.03 3.93 Pot Cap-1 Maneuver 413 240 - - 179 71 - - 14 3 159 32 3 319 Stage 1 - - - - - - - - 21 67 - 86 180 - Stage 2 - - - - - - - - 383 179 - 246 55 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 256 256 - - 76 76 - - ~ 7 1 159 14 1 319 Mov Cap-2 Maneuver - - - - - - - - ~ 7 1 - 14 1 - Stage 1 - - - - - - - - 19 62 - 79 76 - Stage 2 - - - - - - - - 153 75 - 189 51 - Approach EB WB NB SB HCM Control Delay, s 0.2 3.2 $ 331.7 140.9 HCM LOS F F Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) 7 159 256 - - 76 - - 14 319 HCM Lane V/C Ratio 1.353 0.166 0.079 - - 0.584 - - 0.526 0.053 HCM Control Delay (s) $ 1164.1 32.1 20.2 - - 104.6 - -$ 424.4 16.9 HCM Lane LOS F D C - - F - - F C HCM 95th %tile Q(veh) 2 0.6 0.3 - - 2.6 - - 1.3 0.2 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2029 (No Build + 5 Years) AM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 4 Intersection Int Delay, s/veh 13.2 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 1 1 131 155 1 0 37 0 234 0 0 0 Future Vol, veh/h 1 1 131 155 1 0 37 0 234 0 0 0 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 53 53 53 53 53 53 53 53 53 53 53 53 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 2 2 247 292 2 0 70 0 442 0 0 0 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 2 0 0 249 0 0 716 716 126 937 839 2 Stage 1 - - - - - - 130 130 - 586 586 - Stage 2 - - - - - - 586 586 - 351 253 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1614 - - 1311 - - 344 355 922 244 301 1079 Stage 1 - - - - - - 871 787 - 495 495 - Stage 2 - - - - - - 495 495 - 664 696 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1614 - - 1311 - - 285 275 922 105 234 1079 Mov Cap-2 Maneuver - - - - - - 285 275 - 105 234 - Stage 1 - - - - - - 870 786 - 495 385 - Stage 2 - - - - - - 385 385 - 346 695 - Approach EB WB NB SB HCM Control Delay, s 0.1 8.5 22.3 0 HCM LOS C A Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 706 1614 - - 1311 - - - HCM Lane V/C Ratio 0.724 0.001 - - 0.223 - - - HCM Control Delay (s) 22.3 7.2 - - 8.5 - - 0 HCM Lane LOS C A - - A - - A HCM 95th %tile Q(veh) 6.3 0 - - 0.9 - - - Lanes, Volumes, Timings 2029 (No Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU Lane Configurations Traffic Volume (vph) 10 268 1335 202 2 107 1332 284 259 264 110 2 Future Volume (vph) 10 268 1335 202 2 107 1332 284 259 264 110 2 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 1.00 0.95 0.95 0.95 Frt 0.850 0.850 0.956 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 1752 3351 0 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 1752 3351 0 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 138 182 40 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 Adj. Flow (vph) 11 282 1405 213 2 113 1402 299 273 278 116 2 Shared Lane Traffic (%) Lane Group Flow (vph) 0 293 1405 213 0 115 1402 299 273 394 0 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right Left R NA Right R NA Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 15 9 9 Number of Detectors 1 1 2 1 1 1 2 1 1 2 1 Detector Template Left Left Thru Right Left Left Thru Right Left Thru Left Leading Detector (ft) 20 20 100 20 20 20 100 20 20 100 20 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot NA Prot Protected Phases 5 5 2 1 1 6 3 8 7 Permitted Phases 2 6 Lanes, Volumes, Timings 2029 (No Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 2 Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 160 276 525 Future Volume (vph) 160 276 525 Ideal Flow (vphpl) 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 242 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.95 0.95 0.95 Adj. Flow (vph) 168 291 553 Shared Lane Traffic (%) Lane Group Flow (vph) 170 291 553 Enter Blocked Intersection No No No Lane Alignment Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 Turning Speed (mph) 15 9 Number of Detectors 1 2 1 Detector Template Left Thru Right Leading Detector (ft) 20 100 20 Trailing Detector (ft) 0 0 0 Detector 1 Position(ft) 0 0 0 Detector 1 Size(ft) 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot NA Perm Protected Phases 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2029 (No Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU Detector Phase 5 5 2 2 1 1 6 6 3 8 7 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 45.0 12.0 Total Split (s) 31.0 31.0 60.0 60.0 18.0 18.0 47.0 47.0 30.0 41.0 31.0 Total Split (%) 20.7% 20.7% 40.0% 40.0% 12.0% 12.0% 31.3% 31.3% 20.0% 27.3% 20.7% Maximum Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 34.0 24.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lag Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 24.0 53.0 53.0 11.0 40.0 40.0 23.0 39.5 Actuated g/C Ratio 0.16 0.35 0.35 0.07 0.27 0.27 0.15 0.26 v/c Ratio 1.05 0.79 0.33 0.90 1.04 0.54 1.02 0.43 Control Delay 125.6 47.4 14.0 124.0 89.6 21.7 121.5 43.2 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 125.6 47.4 14.0 124.0 89.6 21.7 121.5 43.2 LOS F D B F F C F D Approach Delay 55.7 80.6 75.3 Approach LOS E F E 90th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 34.0 24.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Max 70th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 36.3 21.7 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 50th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 39.1 18.9 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 30th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 42.0 16.0 30th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 10th %ile Green (s) 24.0 24.0 53.1 53.1 10.9 10.9 40.0 40.0 23.0 46.1 11.9 10th %ile Term Code Max Max Coord Coord Gap Gap Coord Coord Max Hold Gap Queue Length 50th (ft) ~310 451 50 114 ~542 95 ~282 150 Queue Length 95th (ft) #503 511 118 #237 #641 194 #470 213 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 280 1780 643 128 1342 551 268 912 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 1.05 0.79 0.33 0.90 1.04 0.54 1.02 0.43 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2029 (No Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 4 Lane Group SBL SBT SBR Detector Phase 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 12.0 43.0 43.0 Total Split (s) 31.0 42.0 42.0 Total Split (%) 20.7% 28.0% 28.0% Maximum Green (s) 24.0 35.0 35.0 Yellow Time (s) 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 Recall Mode None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 18.5 35.0 35.0 Actuated g/C Ratio 0.12 0.23 0.23 v/c Ratio 0.79 0.36 1.00 Control Delay 88.0 49.6 70.9 Queue Delay 0.0 0.0 0.0 Total Delay 88.0 49.6 70.9 LOS F D E Approach Delay 67.7 Approach LOS E 90th %ile Green (s) 24.0 35.0 35.0 90th %ile Term Code Max Max Max 70th %ile Green (s) 21.7 35.0 35.0 70th %ile Term Code Gap Max Max 50th %ile Green (s) 18.9 35.0 35.0 50th %ile Term Code Gap Max Max 30th %ile Green (s) 16.0 35.0 35.0 30th %ile Term Code Gap Max Max 10th %ile Green (s) 11.9 35.0 35.0 10th %ile Term Code Gap Max Max Queue Length 50th (ft) 164 126 ~351 Queue Length 95th (ft) 241 172 #608 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 280 817 551 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.61 0.36 1.00 Intersection Summary Lanes, Volumes, Timings 2029 (No Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 5 Cycle Length: 150 Actuated Cycle Length: 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 150 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.05 Intersection Signal Delay: 68.7 Intersection LOS: E Intersection Capacity Utilization 111.3% ICU Level of Service H Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2029 (No Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 60 30 42 31 47 31 41 Maximum Split (%) 12.0% 40.0% 20.0% 28.0% 20.7% 31.3% 20.7% 27.3% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 84 102 12 42 84 115 12 43 End Time (s) 102 12 42 84 115 12 43 84 Yield/Force Off (s) 95 5 35 77 108 5 36 77 Yield/Force Off 170(s) 95 129 35 48 108 130 36 46 Local Start Time (s) 79 97 7 37 79 110 7 38 Local Yield (s) 90 0 30 72 103 0 31 72 Local Yield 170(s) 90 124 30 43 103 125 31 41 Intersection Summary Cycle Length 150 Control Type Actuated-Coordinated Natural Cycle 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2029 (No Build + 5 Years) School PM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 1 Intersection Int Delay, s/veh 18.7 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 122 0 66 3 0 29 45 456 9 26 25 425 123 Future Vol, veh/h 122 0 66 3 0 29 45 456 9 26 25 425 123 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free RT Channelized - - None - - None - - None - - - None Storage Length - - 100 - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - 0 - - - 0 - Grade, % - 0 - - 0 - - 0 - - - 0 - Peak Hour Factor 76 76 76 76 76 76 76 76 76 92 76 76 76 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 161 0 87 4 0 38 59 600 12 28 33 559 162 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 1099 1411 280 1126 1567 306 721 0 0 612 612 0 0 Stage 1 681 681 - 724 724 - - - - - - - - Stage 2 418 730 - 402 843 - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 166 136 714 158 109 687 870 - - 584 956 - - Stage 1 404 446 - 381 426 - - - - - - - - Stage 2 580 423 - 593 375 - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver ~ 139 116 714 123 93 687 870 - - 720 720 - - Mov Cap-2 Maneuver ~ 139 116 - 123 93 - - - - - - - - Stage 1 377 408 - 355 397 - - - - - - - - Stage 2 511 394 - 477 343 - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 125 13.2 0.8 0.8 HCM LOS F B Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 870 - - 139 714 480 720 - - HCM Lane V/C Ratio 0.068 - - 1.155 0.122 0.088 0.085 - - HCM Control Delay (s) 9.4 - - 186.9 10.7 13.2 10.5 - - HCM Lane LOS A - - F B B B - - HCM 95th %tile Q(veh) 0.2 - - 9.2 0.4 0.3 0.3 - - Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2029 (No Build + 5 Years) School PM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 2 Intersection Int Delay, s/veh 5.3 Movement EBL EBR NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 69 75 55 436 7 432 50 Future Vol, veh/h 69 75 55 436 7 432 50 Conflicting Peds, #/hr 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free RT Channelized - None - None - - None Storage Length 100 0 160 - - - 110 Veh in Median Storage, # 0 - - 0 - 0 - Grade, % 0 - - 0 - 0 - Peak Hour Factor 65 65 65 65 92 65 65 Heavy Vehicles, % 3 3 3 3 3 3 3 Mvmt Flow 106 115 85 671 8 665 77 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 1187 333 742 0 671 - 0 Stage 1 681 - - - - - - Stage 2 506 - - - - - - Critical Hdwy 6.86 6.96 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - Follow-up Hdwy 3.53 3.33 2.23 - 2.53 - - Pot Cap-1 Maneuver 180 660 854 - 535 - - Stage 1 461 - - - - - - Stage 2 568 - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 158 660 854 - 535 - - Mov Cap-2 Maneuver 158 - - - - - - Stage 1 415 - - - - - - Stage 2 553 - - - - - - Approach EB NB SB HCM Control Delay, s 37.2 1.1 0.1 HCM LOS E Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 854 - 158 660 - - HCM Lane V/C Ratio 0.099 - 0.672 0.175 - - HCM Control Delay (s) 9.7 - 65 11.6 - - HCM Lane LOS A - F B - - HCM 95th %tile Q(veh) 0.3 - 3.9 0.6 - - HCM 6th TWSC 2029 (No Build + 5 Years) School PM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 3 Intersection Int Delay, s/veh 107 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 17 50 1639 178 6 62 2046 54 33 3 135 3 1 3 83 Future Vol, veh/h 17 50 1639 178 6 62 2046 54 33 3 135 3 1 3 83 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - - None Storage Length - 345 - 180 - 200 - - - - 100 - - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - - 0 - Grade, % - - 0 - - - 0 - - 0 - - - 0 - Peak Hour Factor 92 95 95 95 92 95 95 95 95 95 95 92 95 95 95 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 18 53 1725 187 7 65 2154 57 35 3 142 3 1 3 87 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1614 2211 0 0 1259 1912 0 0 2874 4222 863 0 3161 4381 1106 Stage 1 - - - - - - - - 1867 1867 - 0 2327 2327 - Stage 2 - - - - - - - - 1007 2355 - 0 834 2054 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.16 - 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.93 - 3.83 4.03 3.93 Pot Cap-1 Maneuver 197 96 - - 312 137 - - ~ 17 ~ 2 254 0 11 ~ 2 175 Stage 1 - - - - - - - - 48 119 - 0 22 69 - Stage 2 - - - - - - - - 231 67 - 0 296 96 - Platoon blocked, % - - - - - Mov Cap-1 Maneuver 98 98 - - 138 138 - - ~ 2 0 254 0 ~ 1 0 175 Mov Cap-2 Maneuver - - - - - - - - ~ 2 0 - 0 ~ 1 0 - Stage 1 - - - - - - - - ~ 13 33 - 0 6 33 - Stage 2 - - - - - - - - 50 32 - 0 32 26 - Approach EB WB NB SB HCM Control Delay, s 3.8 1.8 $ 2442.9 $ 366 HCM LOS F F Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) 2 254 98 - - 138 - - 1 175 HCM Lane V/C Ratio 18.947 0.559 0.726 - - 0.52 - - 4.211 0.499 HCM Control Delay (s) $ 11469.4 35.8 105.8 - - 56.6 - -$ 7037.1 44.5 HCM Lane LOS F E F - - F - - F E HCM 95th %tile Q(veh) 6.6 3.1 3.8 - - 2.5 - - 1.5 2.4 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2029 (No Build + 5 Years) School PM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 4 Intersection Int Delay, s/veh 8.9 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 1 14 30 78 11 14 10 2 106 23 0 7 Future Vol, veh/h 1 14 30 78 11 14 10 2 106 23 0 7 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 39 39 39 39 39 39 39 39 39 39 39 39 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 3 36 77 200 28 36 26 5 272 59 0 18 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 64 0 0 113 0 0 536 545 75 665 565 46 Stage 1 - - - - - - 81 81 - 446 446 - Stage 2 - - - - - - 455 464 - 219 119 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1532 - - 1470 - - 454 444 984 372 433 1021 Stage 1 - - - - - - 925 826 - 590 572 - Stage 2 - - - - - - 583 562 - 781 795 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1532 - - 1470 - - 399 383 984 238 373 1021 Mov Cap-2 Maneuver - - - - - - 399 383 - 238 373 - Stage 1 - - - - - - 923 824 - 589 494 - Stage 2 - - - - - - 495 486 - 561 793 - Approach EB WB NB SB HCM Control Delay, s 0.2 5.9 11.5 21.8 HCM LOS B C Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 855 1532 - - 1470 - - 290 HCM Lane V/C Ratio 0.354 0.002 - - 0.136 - - 0.265 HCM Control Delay (s) 11.5 7.4 - - 7.8 - - 21.8 HCM Lane LOS B A - - A - - C HCM 95th %tile Q(veh) 1.6 0 - - 0.5 - - 1 Lanes, Volumes, Timings 2029 (No Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 7 304 1569 115 3 131 1681 334 2 285 429 113 Future Volume (vph) 7 304 1569 115 3 131 1681 334 2 285 429 113 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 0.95 1.00 0.95 0.95 Frt 0.850 0.850 0.969 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3396 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3396 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 131 182 20 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Adj. Flow (vph) 7 317 1634 120 3 136 1751 348 2 297 447 118 Shared Lane Traffic (%) Lane Group Flow (vph) 0 324 1634 120 0 139 1751 348 0 299 565 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right R NA Left R NA Right Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 9 15 9 Number of Detectors 1 1 2 1 1 1 2 1 1 1 2 Detector Template Left Left Thru Right Left Left Thru Right Left Left Thru Leading Detector (ft) 20 20 100 20 20 20 100 20 20 20 100 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 20 6 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases 2 6 Lanes, Volumes, Timings 2029 (No Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 2 Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 177 255 595 Future Volume (vph) 177 255 595 Ideal Flow (vphpl) 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 243 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.96 0.96 0.96 Adj. Flow (vph) 184 266 620 Shared Lane Traffic (%) Lane Group Flow (vph) 184 266 620 Enter Blocked Intersection No No No Lane Alignment Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 Turning Speed (mph) 15 9 Number of Detectors 1 2 1 Detector Template Left Thru Right Leading Detector (ft) 20 100 20 Trailing Detector (ft) 0 0 0 Detector 1 Position(ft) 0 0 0 Detector 1 Size(ft) 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot NA Perm Protected Phases 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2029 (No Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Detector Phase 5 5 2 2 1 1 6 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 12.0 45.0 Total Split (s) 31.0 31.0 60.0 60.0 18.0 18.0 47.0 47.0 30.0 30.0 41.0 Total Split (%) 20.7% 20.7% 40.0% 40.0% 12.0% 12.0% 31.3% 31.3% 20.0% 20.0% 27.3% Maximum Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 34.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lead Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 24.0 53.0 53.0 11.0 40.0 40.0 23.0 38.6 Actuated g/C Ratio 0.16 0.35 0.35 0.07 0.27 0.27 0.15 0.26 v/c Ratio 1.16 0.92 0.19 1.09 1.30 0.63 1.12 0.64 Control Delay 156.8 55.7 4.7 166.4 185.7 28.1 145.6 52.2 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 156.8 55.7 4.7 166.4 185.7 28.1 145.6 52.2 LOS F E A F F C F D Approach Delay 68.5 160.0 84.5 Approach LOS E F F 90th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 34.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Max 70th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 35.0 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 50th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 37.9 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 30th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 40.9 30th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 10th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 45.1 10th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold Queue Length 50th (ft) ~373 559 0 ~152 ~802 144 ~334 253 Queue Length 95th (ft) #572 628 37 #298 #897 258 #527 332 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 280 1779 638 128 1342 551 268 888 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 1.16 0.92 0.19 1.09 1.30 0.63 1.12 0.64 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2029 (No Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 4 Lane Group SBL SBT SBR Detector Phase 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 12.0 43.0 43.0 Total Split (s) 31.0 42.0 42.0 Total Split (%) 20.7% 28.0% 28.0% Maximum Green (s) 24.0 35.0 35.0 Yellow Time (s) 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 Recall Mode None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 19.4 35.0 35.0 Actuated g/C Ratio 0.13 0.23 0.23 v/c Ratio 0.81 0.33 1.12 Control Delay 89.4 49.0 108.0 Queue Delay 0.0 0.0 0.0 Total Delay 89.4 49.0 108.0 LOS F D F Approach Delay 90.1 Approach LOS F 90th %ile Green (s) 24.0 35.0 35.0 90th %ile Term Code Max Max Max 70th %ile Green (s) 23.0 35.0 35.0 70th %ile Term Code Gap Max Max 50th %ile Green (s) 20.1 35.0 35.0 50th %ile Term Code Gap Max Max 30th %ile Green (s) 17.1 35.0 35.0 30th %ile Term Code Gap Max Max 10th %ile Green (s) 12.9 35.0 35.0 10th %ile Term Code Gap Max Max Queue Length 50th (ft) 177 114 ~505 Queue Length 95th (ft) 259 158 #750 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 280 817 552 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.66 0.33 1.12 Intersection Summary Lanes, Volumes, Timings 2029 (No Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 5 Cycle Length: 150 Actuated Cycle Length: 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 150 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.30 Intersection Signal Delay: 107.2 Intersection LOS: F Intersection Capacity Utilization 125.8% ICU Level of Service H Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2029 (No Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 60 30 42 31 47 31 41 Maximum Split (%) 12.0% 40.0% 20.0% 28.0% 20.7% 31.3% 20.7% 27.3% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 84 102 12 42 84 115 12 43 End Time (s) 102 12 42 84 115 12 43 84 Yield/Force Off (s) 95 5 35 77 108 5 36 77 Yield/Force Off 170(s) 95 129 35 48 108 130 36 46 Local Start Time (s) 79 97 7 37 79 110 7 38 Local Yield (s) 90 0 30 72 103 0 31 72 Local Yield 170(s) 90 124 30 43 103 125 31 41 Intersection Summary Cycle Length 150 Control Type Actuated-Coordinated Natural Cycle 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2029 (No Build + 5 Years) Commuter PM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 1 Intersection Int Delay, s/veh 6.2 Movement EBL EBT EBR WBL WBT WBR NBU NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 93 0 48 18 0 63 3 54 590 18 15 54 358 97 Future Vol, veh/h 93 0 48 18 0 63 3 54 590 18 15 54 358 97 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free Free RT Channelized - - None - - None - - - None - - - None Storage Length - - 100 - - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - - 0 - - - 0 - Grade, % - 0 - - 0 - - - 0 - - - 0 - Peak Hour Factor 92 92 92 92 92 92 92 92 92 92 92 92 92 92 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 101 0 52 20 0 68 3 59 641 20 16 59 389 105 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 984 1324 195 1120 1419 331 389 494 0 0 661 661 0 0 Stage 1 539 539 - 775 775 - - - - - - - - - Stage 2 445 785 - 345 644 - - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 6.46 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.53 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 201 153 810 160 134 662 809 1059 - - 543 917 - - Stage 1 492 518 - 355 404 - - - - - - - - - Stage 2 559 399 - 641 464 - - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 159 130 810 132 114 662 1038 1038 - - 771 771 - - Mov Cap-2 Maneuver 159 130 - 132 114 - - - - - - - - - Stage 1 462 468 - 334 380 - - - - - - - - - Stage 2 471 375 - 541 419 - - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 43.3 18.7 0.7 1.3 HCM LOS E C Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 1038 - - 159 810 350 771 - - HCM Lane V/C Ratio 0.06 - - 0.636 0.064 0.252 0.097 - - HCM Control Delay (s) 8.7 - - 60.6 9.8 18.7 10.2 - - HCM Lane LOS A - - F A C B - - HCM 95th %tile Q(veh) 0.2 - - 3.5 0.2 1 0.3 - - HCM 6th TWSC 2029 (No Build + 5 Years) Commuter PM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 2 Intersection Int Delay, s/veh 0.4 Movement EBL EBR NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 10 6 9 631 10 413 2 Future Vol, veh/h 10 6 9 631 10 413 2 Conflicting Peds, #/hr 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free RT Channelized - None - None - - None Storage Length 100 0 160 - - - 110 Veh in Median Storage, # 0 - - 0 - 0 - Grade, % 0 - - 0 - 0 - Peak Hour Factor 83 83 83 83 92 83 83 Heavy Vehicles, % 3 3 3 3 3 3 3 Mvmt Flow 12 7 11 760 11 498 2 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 922 249 500 0 760 - 0 Stage 1 520 - - - - - - Stage 2 402 - - - - - - Critical Hdwy 6.86 6.96 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - Follow-up Hdwy 3.53 3.33 2.23 - 2.53 - - Pot Cap-1 Maneuver 267 748 1053 - 470 - - Stage 1 558 - - - - - - Stage 2 641 - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 256 748 1053 - 470 - - Mov Cap-2 Maneuver 256 - - - - - - Stage 1 552 - - - - - - Stage 2 620 - - - - - - Approach EB NB SB HCM Control Delay, s 16.1 0.1 0.3 HCM LOS C Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 1053 - 256 748 - - HCM Lane V/C Ratio 0.01 - 0.047 0.01 - - HCM Control Delay (s) 8.5 - 19.8 9.9 - - HCM Lane LOS A - C A - - HCM 95th %tile Q(veh) 0 - 0.1 0 - - HCM 6th TWSC 2029 (No Build + 5 Years) Commuter PM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 3 Intersection Int Delay, s/veh 3.9 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 15 45 1701 113 1 68 2444 50 18 5 135 7 2 2 72 Future Vol, veh/h 15 45 1701 113 1 68 2444 50 18 5 135 7 2 2 72 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - - None Storage Length - 345 - 180 - 200 - - - - 100 - - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - - 0 - Grade, % - - 0 - - - 0 - - 0 - - - 0 - Peak Hour Factor 92 96 96 96 92 96 96 96 96 96 96 92 96 96 96 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 16 47 1772 118 1 71 2546 52 19 5 141 8 2 2 75 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1896 2598 0 0 1293 1890 0 0 3061 4640 886 0 3553 4732 1299 Stage 1 - - - - - - - - 1898 1898 - 0 2716 2716 - Stage 2 - - - - - - - - 1163 2742 - 0 837 2016 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.16 - 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.93 - 3.83 4.03 3.93 Pot Cap-1 Maneuver 136 61 - - 299 140 - - ~ 13 ~ 1 245 0 6 ~ 1 129 Stage 1 - - - - - - - - 45 115 - 0 11 43 - Stage 2 - - - - - - - - 184 42 - 0 295 100 - Platoon blocked, % - - - - - Mov Cap-1 Maneuver 61 61 - - 140 140 - - - 0 245 0 - 0 129 Mov Cap-2 Maneuver - - - - - - - - - 0 - 0 - 0 - Stage 1 - - - - - - - - 45 0 - 0 11 21 - Stage 2 - - - - - - - - 34 20 - 0 - 0 - Approach EB WB NB SB HCM Control Delay, s 7.8 1.5 HCM LOS - - Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) - 245 61 - - 140 - - - 129 HCM Lane V/C Ratio - 0.574 1.036 - - 0.514 - - - 0.581 HCM Control Delay (s) - 37.8 240.1 - - 55.2 - - - 65.9 HCM Lane LOS - E F - - F - - - F HCM 95th %tile Q(veh) - 3.2 5 - - 2.5 - - - 2.9 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2029 (No Build + 5 Years) Commuter PM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 4 Intersection Int Delay, s/veh 2.6 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 0 8 0 1 8 2 0 0 7 0 0 0 Future Vol, veh/h 0 8 0 1 8 2 0 0 7 0 0 0 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 82 82 82 82 82 82 82 82 82 82 82 82 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 0 10 0 1 10 2 0 0 9 0 0 0 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 12 0 0 10 0 0 23 24 10 28 23 11 Stage 1 - - - - - - 10 10 - 13 13 - Stage 2 - - - - - - 13 14 - 15 10 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1600 - - 1603 - - 986 867 1068 979 869 1067 Stage 1 - - - - - - 1008 885 - 1005 883 - Stage 2 - - - - - - 1005 882 - 1002 885 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1600 - - 1603 - - 986 866 1068 971 868 1067 Mov Cap-2 Maneuver - - - - - - 986 866 - 971 868 - Stage 1 - - - - - - 1008 885 - 1005 882 - Stage 2 - - - - - - 1004 881 - 994 885 - Approach EB WB NB SB HCM Control Delay, s 0 0.7 8.4 0 HCM LOS A A Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 1068 1600 - - 1603 - - - HCM Lane V/C Ratio 0.008 - - - 0.001 - - - HCM Control Delay (s) 8.4 0 - - 7.2 - - 0 HCM Lane LOS A A - - A - - A HCM 95th %tile Q(veh) 0 0 - - 0 - - - Lanes, Volumes, Timings 2024 Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 2 215 1542 257 7 83 587 111 1 194 292 80 Future Volume (vph) 2 215 1542 257 7 83 587 111 1 194 292 80 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 0.95 1.00 0.95 0.95 Frt 0.850 0.850 0.968 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3393 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3393 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 166 210 24 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Adj. Flow (vph) 2 224 1606 268 7 86 611 116 1 202 304 83 Shared Lane Traffic (%) Lane Group Flow (vph) 0 226 1606 268 0 93 611 116 0 203 387 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right R NA Left R NA Right Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 9 15 9 Number of Detectors 1 1 2 1 1 1 2 1 1 1 2 Detector Template Left Left Thru Right Left Left Thru Right Left Left Thru Leading Detector (ft) 20 20 100 20 20 20 100 20 20 20 100 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 20 6 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases 2 6 Lanes, Volumes, Timings 2024 Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 2 Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 1 194 279 486 Future Volume (vph) 1 194 279 486 Ideal Flow (vphpl) 1900 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 0.95 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 0 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 0 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 333 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.92 0.96 0.96 0.96 Adj. Flow (vph) 1 202 291 506 Shared Lane Traffic (%) Lane Group Flow (vph) 0 203 291 506 Enter Blocked Intersection No No No No Lane Alignment R NA Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 Number of Detectors 1 1 2 1 Detector Template Left Left Thru Right Leading Detector (ft) 20 20 100 20 Trailing Detector (ft) 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot Prot NA Perm Protected Phases 7 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2024 Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Detector Phase 5 5 2 2 1 1 6 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 12.0 45.0 Total Split (s) 27.0 27.0 48.0 48.0 18.0 18.0 39.0 39.0 35.0 35.0 35.0 Total Split (%) 20.8% 20.8% 36.9% 36.9% 13.8% 13.8% 30.0% 30.0% 26.9% 26.9% 26.9% Maximum Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 28.0 28.0 28.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lead Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 19.3 49.6 49.6 9.9 40.2 40.2 19.4 24.0 Actuated g/C Ratio 0.15 0.38 0.38 0.08 0.31 0.31 0.15 0.18 v/c Ratio 0.87 0.84 0.38 0.70 0.39 0.18 0.78 0.60 Control Delay 84.4 42.8 14.4 84.6 38.3 0.6 72.6 48.9 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 84.4 42.8 14.4 84.6 38.3 0.6 72.6 48.9 LOS F D B F D A E D Approach Delay 43.7 38.2 57.0 Approach LOS D D E 90th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 26.4 26.4 28.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Gap Gap Hold 70th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 22.3 22.3 28.0 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Gap Gap Hold 50th %ile Green (s) 22.3 22.3 43.1 43.1 11.4 11.4 32.2 32.2 19.4 19.4 28.1 50th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Hold 30th %ile Green (s) 19.3 19.3 53.5 53.5 9.5 9.5 43.7 43.7 16.6 16.6 22.4 30th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Hold 10th %ile Green (s) 15.0 15.0 69.6 69.6 6.7 6.7 61.3 61.3 12.3 12.3 13.3 10th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Gap Queue Length 50th (ft) 183 484 61 77 162 0 167 143 Queue Length 95th (ft) #324 #617 144 #147 204 0 239 195 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 275 1923 701 149 1558 630 377 750 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 0.82 0.84 0.38 0.62 0.39 0.18 0.54 0.52 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2024 Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 4 Lane Group SBU SBL SBT SBR Detector Phase 7 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 43.0 43.0 Total Split (s) 29.0 29.0 29.0 29.0 Total Split (%) 22.3% 22.3% 22.3% 22.3% Maximum Green (s) 22.0 22.0 22.0 22.0 Yellow Time (s) 4.0 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 Recall Mode None None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 18.5 23.0 23.0 Actuated g/C Ratio 0.14 0.18 0.18 v/c Ratio 0.82 0.47 0.92 Control Delay 78.5 50.0 40.1 Queue Delay 0.0 0.0 0.0 Total Delay 78.5 50.0 40.1 LOS E D D Approach Delay 50.8 Approach LOS D 90th %ile Green (s) 22.0 22.0 23.6 23.6 90th %ile Term Code Max Max Max Max 70th %ile Green (s) 22.0 22.0 27.7 27.7 70th %ile Term Code Max Max Max Max 50th %ile Green (s) 19.4 19.4 28.1 28.1 50th %ile Term Code Gap Gap Gap Gap 30th %ile Green (s) 16.6 16.6 22.4 22.4 30th %ile Term Code Gap Gap Gap Gap 10th %ile Green (s) 12.4 12.4 13.4 13.4 10th %ile Term Code Gap Gap Hold Hold Queue Length 50th (ft) 167 111 150 Queue Length 95th (ft) 249 163 #373 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 296 667 568 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.69 0.44 0.89 Intersection Summary Lanes, Volumes, Timings 2024 Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 5 Cycle Length: 130 Actuated Cycle Length: 130 Offset: 5 (4%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 120 Control Type: Actuated-Coordinated Maximum v/c Ratio: 0.92 Intersection Signal Delay: 46.0 Intersection LOS: D Intersection Capacity Utilization 87.6% ICU Level of Service E Analysis Period (min) 15 # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2024 Build AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 48 35 29 27 39 29 35 Maximum Split (%) 13.8% 36.9% 26.9% 22.3% 20.8% 30.0% 22.3% 26.9% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 76 94 12 47 76 103 12 41 End Time (s) 94 12 47 76 103 12 41 76 Yield/Force Off (s) 87 5 40 69 96 5 34 69 Yield/Force Off 170(s) 87 109 40 40 96 110 34 38 Local Start Time (s) 71 89 7 42 71 98 7 36 Local Yield (s) 82 0 35 64 91 0 29 64 Local Yield 170(s) 82 104 35 35 91 105 29 33 Intersection Summary Cycle Length 130 Control Type Actuated-Coordinated Natural Cycle 120 Offset: 5 (4%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2024 Build AM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 1 Intersection Int Delay, s/veh 2.1 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 21 0 15 10 0 50 26 437 13 11 45 501 47 Future Vol, veh/h 21 0 15 10 0 50 26 437 13 11 45 501 47 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free RT Channelized - - None - - None - - None - - - None Storage Length - - 100 - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - 0 - - - 0 - Grade, % - 0 - - 0 - - 0 - - - 0 - Peak Hour Factor 83 83 83 83 83 83 83 83 83 92 83 83 83 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 25 0 18 12 0 60 31 527 16 12 54 604 57 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 1062 1341 302 1031 1390 272 661 0 0 542 543 0 0 Stage 1 736 736 - 597 597 - - - - - - - - Stage 2 326 605 - 434 793 - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 176 150 691 186 140 723 917 - - 647 1015 - - Stage 1 374 421 - 454 487 - - - - - - - - Stage 2 658 483 - 568 396 - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 148 134 691 167 125 723 917 - - 903 903 - - Mov Cap-2 Maneuver 148 134 - 167 125 - - - - - - - - Stage 1 361 390 - 439 470 - - - - - - - - Stage 2 583 467 - 513 367 - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 24.3 14.2 0.5 0.8 HCM LOS C B Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 917 - - 148 691 465 903 - - HCM Lane V/C Ratio 0.034 - - 0.171 0.026 0.155 0.073 - - HCM Control Delay (s) 9.1 - - 34.3 10.4 14.2 9.3 - - HCM Lane LOS A - - D B B A - - HCM 95th %tile Q(veh) 0.1 - - 0.6 0.1 0.5 0.2 - - HCM 6th TWSC 2024 Build AM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 2 Intersection Int Delay, s/veh 7.2 Movement EBL EBR NBU NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 86 131 2 86 381 6 464 65 Future Vol, veh/h 86 131 2 86 381 6 464 65 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free Free RT Channelized - None - - None - - None Storage Length 100 0 - 160 - - - 110 Veh in Median Storage, # 0 - - - 0 - 0 - Grade, % 0 - - - 0 - 0 - Peak Hour Factor 73 73 92 73 73 92 73 73 Heavy Vehicles, % 3 3 3 3 3 3 3 3 Mvmt Flow 118 179 2 118 522 7 636 89 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 1151 318 636 725 0 522 - 0 Stage 1 650 - - - - - - - Stage 2 501 - - - - - - - Critical Hdwy 6.86 6.96 6.46 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - - Follow-up Hdwy 3.53 3.33 2.53 2.23 - 2.53 - - Pot Cap-1 Maneuver 190 675 564 867 - 666 - - Stage 1 479 - - - - - - - Stage 2 571 - - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 160 675 853 853 - 666 - - Mov Cap-2 Maneuver 160 - - - - - - - Stage 1 411 - - - - - - - Stage 2 561 - - - - - - - Approach EB NB SB HCM Control Delay, s 36.3 1.9 0.1 HCM LOS E Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 853 - 160 675 - - HCM Lane V/C Ratio 0.141 - 0.736 0.266 - - HCM Control Delay (s) 9.9 - 72.9 12.3 - - HCM Lane LOS A - F B - - HCM 95th %tile Q(veh) 0.5 - 4.5 1.1 - - HCM 6th TWSC 2024 Build AM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 3 Intersection Int Delay, s/veh 6.1 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 3 14 1990 147 4 36 1214 14 19 0 24 6 0 14 Future Vol, veh/h 3 14 1990 147 4 36 1214 14 19 0 24 6 0 14 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - None Storage Length - 345 - 180 - 200 - - - - 100 - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - 0 - Grade, % - - 0 - - - 0 - - 0 - - 0 - Peak Hour Factor 92 95 95 95 92 95 95 95 95 95 95 95 95 95 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 5 3 3 3 Mvmt Flow 3 15 2095 155 4 38 1278 15 20 0 25 6 0 15 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 944 1293 0 0 1529 2250 0 0 2726 3508 1048 2244 3656 647 Stage 1 - - - - - - - - 2131 2131 - 1370 1370 - Stage 2 - - - - - - - - 595 1377 - 874 2286 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.2 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.95 3.83 4.03 3.93 Pot Cap-1 Maneuver 468 279 - - 220 92 - - 22 6 189 44 5 353 Stage 1 - - - - - - - - 30 87 - 108 211 - Stage 2 - - - - - - - - 415 209 - 280 73 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 300 300 - - 97 97 - - ~ 13 3 189 24 3 353 Mov Cap-2 Maneuver - - - - - - - - ~ 13 3 - 24 3 - Stage 1 - - - - - - - - 28 82 - 102 120 - Stage 2 - - - - - - - - 226 119 - 228 69 - Approach EB WB NB SB HCM Control Delay, s 0.1 2.1 $ 393.9 71.5 HCM LOS F F Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) 13 189 300 - - 97 - - 24 353 HCM Lane V/C Ratio 1.538 0.134 0.06 - - 0.435 - - 0.263 0.042 HCM Control Delay (s) $ 857.4 27 17.8 - - 67.9 - - 201.9 15.6 HCM Lane LOS F D C - - F - - F C HCM 95th %tile Q(veh) 3.2 0.5 0.2 - - 1.8 - - 0.8 0.1 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2024 Build AM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 4 Intersection Int Delay, s/veh 11 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 1 3 118 141 3 0 34 0 212 0 0 0 Future Vol, veh/h 1 3 118 141 3 0 34 0 212 0 0 0 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 53 53 53 53 53 53 53 53 53 53 53 53 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 2 6 223 266 6 0 64 0 400 0 0 0 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 6 0 0 229 0 0 660 660 118 860 771 6 Stage 1 - - - - - - 122 122 - 538 538 - Stage 2 - - - - - - 538 538 - 322 233 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1608 - - 1333 - - 375 382 931 275 330 1074 Stage 1 - - - - - - 880 793 - 525 521 - Stage 2 - - - - - - 525 521 - 688 710 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1608 - - 1333 - - 317 305 931 133 264 1074 Mov Cap-2 Maneuver - - - - - - 317 305 - 133 264 - Stage 1 - - - - - - 879 792 - 524 417 - Stage 2 - - - - - - 420 417 - 392 709 - Approach EB WB NB SB HCM Control Delay, s 0.1 8.2 18 0 HCM LOS C A Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 734 1608 - - 1333 - - - HCM Lane V/C Ratio 0.632 0.001 - - 0.2 - - - HCM Control Delay (s) 18 7.2 - - 8.4 - - 0 HCM Lane LOS C A - - A - - A HCM 95th %tile Q(veh) 4.5 0 - - 0.7 - - - Lanes, Volumes, Timings 2024 Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU Lane Configurations Traffic Volume (vph) 9 243 1212 183 2 108 1209 257 235 252 114 2 Future Volume (vph) 9 243 1212 183 2 108 1209 257 235 252 114 2 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 1.00 0.95 0.95 0.95 Frt 0.850 0.850 0.953 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 1752 3340 0 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 1752 3340 0 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 138 182 45 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.92 Adj. Flow (vph) 9 256 1276 193 2 114 1273 271 247 265 120 2 Shared Lane Traffic (%) Lane Group Flow (vph) 0 265 1276 193 0 116 1273 271 247 385 0 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right Left R NA Right R NA Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 15 9 9 Number of Detectors 1 1 2 1 1 1 2 1 1 2 1 Detector Template Left Left Thru Right Left Left Thru Right Left Thru Left Leading Detector (ft) 20 20 100 20 20 20 100 20 20 100 20 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot NA Prot Protected Phases 5 5 2 1 1 6 3 8 7 Permitted Phases 2 6 Lanes, Volumes, Timings 2024 Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 2 Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 145 261 475 Future Volume (vph) 145 261 475 Ideal Flow (vphpl) 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 254 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.95 0.95 0.95 Adj. Flow (vph) 153 275 500 Shared Lane Traffic (%) Lane Group Flow (vph) 155 275 500 Enter Blocked Intersection No No No Lane Alignment Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 Turning Speed (mph) 15 9 Number of Detectors 1 2 1 Detector Template Left Thru Right Leading Detector (ft) 20 100 20 Trailing Detector (ft) 0 0 0 Detector 1 Position(ft) 0 0 0 Detector 1 Size(ft) 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot NA Perm Protected Phases 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2024 Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU Detector Phase 5 5 2 2 1 1 6 6 3 8 7 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 45.0 12.0 Total Split (s) 31.0 31.0 60.0 60.0 18.0 18.0 47.0 47.0 30.0 41.0 31.0 Total Split (%) 20.7% 20.7% 40.0% 40.0% 12.0% 12.0% 31.3% 31.3% 20.0% 27.3% 20.7% Maximum Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 34.0 24.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lag Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 24.4 57.0 57.0 11.7 44.3 44.3 22.4 35.7 Actuated g/C Ratio 0.16 0.38 0.38 0.08 0.30 0.30 0.15 0.24 v/c Ratio 0.93 0.67 0.28 0.85 0.86 0.46 0.95 0.46 Control Delay 99.5 41.6 11.8 112.4 57.3 17.7 106.0 44.6 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 99.5 41.6 11.8 112.4 57.3 17.7 106.0 44.6 LOS F D B F E B F D Approach Delay 47.1 54.6 68.6 Approach LOS D D E 90th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 34.0 24.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Max 70th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 37.7 20.3 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 50th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 40.4 17.6 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 30th %ile Green (s) 27.5 27.5 55.0 55.0 14.4 14.4 41.9 41.9 23.0 37.7 14.9 30th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Max Hold Gap 10th %ile Green (s) 22.5 22.5 71.2 71.2 11.1 11.1 59.8 59.8 20.2 28.7 11.0 10th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Hold Gap Queue Length 50th (ft) 260 395 36 115 450 69 242 142 Queue Length 95th (ft) #438 452 98 #241 #545 161 #413 205 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 288 1915 681 136 1488 591 268 852 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 0.92 0.67 0.28 0.85 0.86 0.46 0.92 0.45 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2024 Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 4 Lane Group SBL SBT SBR Detector Phase 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 12.0 43.0 43.0 Total Split (s) 31.0 42.0 42.0 Total Split (%) 20.7% 28.0% 28.0% Maximum Green (s) 24.0 35.0 35.0 Yellow Time (s) 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 Recall Mode None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 17.6 30.8 30.8 Actuated g/C Ratio 0.12 0.21 0.21 v/c Ratio 0.76 0.38 0.96 Control Delay 86.0 52.1 57.8 Queue Delay 0.0 0.0 0.0 Total Delay 86.0 52.1 57.8 LOS F D E Approach Delay 60.8 Approach LOS E 90th %ile Green (s) 24.0 35.0 35.0 90th %ile Term Code Max Max Max 70th %ile Green (s) 20.3 35.0 35.0 70th %ile Term Code Gap Max Max 50th %ile Green (s) 17.6 35.0 35.0 50th %ile Term Code Gap Max Max 30th %ile Green (s) 14.9 29.6 29.6 30th %ile Term Code Gap Gap Gap 10th %ile Green (s) 11.0 19.5 19.5 10th %ile Term Code Gap Gap Gap Queue Length 50th (ft) 149 118 258 Queue Length 95th (ft) 221 163 #471 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 280 817 560 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.55 0.34 0.89 Intersection Summary Lanes, Volumes, Timings 2024 Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 5 Cycle Length: 150 Actuated Cycle Length: 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 130 Control Type: Actuated-Coordinated Maximum v/c Ratio: 0.96 Intersection Signal Delay: 54.9 Intersection LOS: D Intersection Capacity Utilization 103.1% ICU Level of Service G Analysis Period (min) 15 # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2024 Build School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 60 30 42 31 47 31 41 Maximum Split (%) 12.0% 40.0% 20.0% 28.0% 20.7% 31.3% 20.7% 27.3% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 84 102 12 42 84 115 12 43 End Time (s) 102 12 42 84 115 12 43 84 Yield/Force Off (s) 95 5 35 77 108 5 36 77 Yield/Force Off 170(s) 95 129 35 48 108 130 36 46 Local Start Time (s) 79 97 7 37 79 110 7 38 Local Yield (s) 90 0 30 72 103 0 31 72 Local Yield 170(s) 90 124 30 43 103 125 31 41 Intersection Summary Cycle Length 150 Control Type Actuated-Coordinated Natural Cycle 130 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2024 Build School PM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 1 Intersection Int Delay, s/veh 20.2 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 138 0 74 3 0 27 52 413 8 23 22 385 134 Future Vol, veh/h 138 0 74 3 0 27 52 413 8 23 22 385 134 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free RT Channelized - - None - - None - - None - - - None Storage Length - - 100 - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - 0 - - - 0 - Grade, % - 0 - - 0 - - 0 - - - 0 - Peak Hour Factor 76 76 76 76 76 76 76 76 76 92 76 76 76 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 182 0 97 4 0 36 68 543 11 25 29 507 176 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 1023 1305 254 1047 1476 277 683 0 0 554 554 0 0 Stage 1 615 615 - 685 685 - - - - - - - - Stage 2 408 690 - 362 791 - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 188 158 742 181 124 717 899 - - 636 1005 - - Stage 1 443 478 - 402 444 - - - - - - - - Stage 2 588 442 - 626 397 - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver ~ 159 136 742 140 107 717 899 - - 775 775 - - Mov Cap-2 Maneuver ~ 159 136 - 140 107 - - - - - - - - Stage 1 409 445 - 371 410 - - - - - - - - Stage 2 517 408 - 506 369 - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 115.7 12.7 1 0.7 HCM LOS F B Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 899 - - 159 742 508 775 - - HCM Lane V/C Ratio 0.076 - - 1.142 0.131 0.078 0.07 - - HCM Control Delay (s) 9.3 - - 172.1 10.6 12.7 10 - - HCM Lane LOS A - - F B B A - - HCM 95th %tile Q(veh) 0.2 - - 9.8 0.5 0.3 0.2 - - Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2024 Build School PM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 2 Intersection Int Delay, s/veh 4 Movement EBL EBR NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 62 72 53 406 6 405 45 Future Vol, veh/h 62 72 53 406 6 405 45 Conflicting Peds, #/hr 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free RT Channelized - None - None - - None Storage Length 100 0 160 - - - 110 Veh in Median Storage, # 0 - - 0 - 0 - Grade, % 0 - - 0 - 0 - Peak Hour Factor 65 65 65 65 92 65 65 Heavy Vehicles, % 3 3 3 3 3 3 3 Mvmt Flow 95 111 82 625 7 623 69 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 1114 312 692 0 625 - 0 Stage 1 637 - - - - - - Stage 2 477 - - - - - - Critical Hdwy 6.86 6.96 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - Follow-up Hdwy 3.53 3.33 2.23 - 2.53 - - Pot Cap-1 Maneuver 201 681 892 - 573 - - Stage 1 486 - - - - - - Stage 2 587 - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 179 681 892 - 573 - - Mov Cap-2 Maneuver 179 - - - - - - Stage 1 441 - - - - - - Stage 2 575 - - - - - - Approach EB NB SB HCM Control Delay, s 27.4 1.1 0.1 HCM LOS D Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 892 - 179 681 - - HCM Lane V/C Ratio 0.091 - 0.533 0.163 - - HCM Control Delay (s) 9.4 - 46 11.3 - - HCM Lane LOS A - E B - - HCM 95th %tile Q(veh) 0.3 - 2.7 0.6 - - HCM 6th TWSC 2024 Build School PM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 3 Intersection Int Delay, s/veh 1.5 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 15 45 1484 178 5 59 1853 49 50 3 126 3 1 3 75 Future Vol, veh/h 15 45 1484 178 5 59 1853 49 50 3 126 3 1 3 75 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - - None Storage Length - 345 - 180 - 200 - - - - 100 - - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - - 0 - Grade, % - - 0 - - - 0 - - 0 - - - 0 - Peak Hour Factor 92 95 95 95 92 95 95 95 95 95 95 92 95 95 95 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 16 47 1562 187 5 62 1951 52 53 3 133 3 1 3 79 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1462 2003 0 0 1140 1749 0 0 2604 3825 781 0 2863 3986 1002 Stage 1 - - - - - - - - 1688 1688 - 0 2111 2111 - Stage 2 - - - - - - - - 916 2137 - 0 752 1875 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.16 - 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.93 - 3.83 4.03 3.93 Pot Cap-1 Maneuver 240 123 - - 364 166 - - ~ 26 4 288 0 18 ~ 3 205 Stage 1 - - - - - - - - 64 147 - 0 32 89 - Stage 2 - - - - - - - - 263 87 - 0 333 118 - Platoon blocked, % - - - - - Mov Cap-1 Maneuver 129 129 - - 169 169 - - - ~ 1 288 0 - ~ 1 205 Mov Cap-2 Maneuver - - - - - - - - - ~ 1 - 0 - ~ 1 - Stage 1 - - - - - - - - ~ 32 74 - 0 16 53 - Stage 2 - - - - - - - - 91 52 - 0 87 60 - Approach EB WB NB SB HCM Control Delay, s 2 1.3 HCM LOS - - Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) - 288 129 - - 169 - - - 205 HCM Lane V/C Ratio - 0.461 0.494 - - 0.4 - - - 0.385 HCM Control Delay (s) - 27.7 57.2 - - 39.9 - - - 33.2 HCM Lane LOS - D F - - E - - - D HCM 95th %tile Q(veh) - 2.3 2.3 - - 1.8 - - - 1.7 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2024 Build School PM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 4 Intersection Int Delay, s/veh 8.2 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 1 16 28 70 13 12 9 2 96 20 0 6 Future Vol, veh/h 1 16 28 70 13 12 9 2 96 20 0 6 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 39 39 39 39 39 39 39 39 39 39 39 39 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 3 41 72 179 33 31 23 5 246 51 0 15 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 64 0 0 113 0 0 497 505 77 616 526 49 Stage 1 - - - - - - 83 83 - 407 407 - Stage 2 - - - - - - 414 422 - 209 119 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1532 - - 1470 - - 482 468 981 401 455 1017 Stage 1 - - - - - - 923 824 - 619 596 - Stage 2 - - - - - - 614 587 - 791 795 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1532 - - 1470 - - 430 410 981 269 399 1017 Mov Cap-2 Maneuver - - - - - - 430 410 - 269 399 - Stage 1 - - - - - - 921 822 - 618 523 - Stage 2 - - - - - - 531 515 - 588 793 - Approach EB WB NB SB HCM Control Delay, s 0.2 5.7 11.1 19 HCM LOS B C Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 865 1532 - - 1470 - - 324 HCM Lane V/C Ratio 0.317 0.002 - - 0.122 - - 0.206 HCM Control Delay (s) 11.1 7.4 - - 7.8 - - 19 HCM Lane LOS B A - - A - - C HCM 95th %tile Q(veh) 1.4 0 - - 0.4 - - 0.8 Lanes, Volumes, Timings 2024 Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 6 275 1424 104 3 130 1526 303 2 258 402 116 Future Volume (vph) 6 275 1424 104 3 130 1526 303 2 258 402 116 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 0.95 1.00 0.95 0.95 Frt 0.850 0.850 0.966 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3386 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3386 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 131 182 23 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Adj. Flow (vph) 6 286 1483 108 3 135 1590 316 2 269 419 121 Shared Lane Traffic (%) Lane Group Flow (vph) 0 292 1483 108 0 138 1590 316 0 271 540 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right R NA Left R NA Right Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 9 15 9 Number of Detectors 1 1 2 1 1 1 2 1 1 1 2 Detector Template Left Left Thru Right Left Left Thru Right Left Left Thru Leading Detector (ft) 20 20 100 20 20 20 100 20 20 20 100 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 20 6 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases 2 6 Lanes, Volumes, Timings 2024 Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 2 Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 160 242 539 Future Volume (vph) 160 242 539 Ideal Flow (vphpl) 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 252 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.96 0.96 0.96 Adj. Flow (vph) 167 252 561 Shared Lane Traffic (%) Lane Group Flow (vph) 167 252 561 Enter Blocked Intersection No No No Lane Alignment Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 Turning Speed (mph) 15 9 Number of Detectors 1 2 1 Detector Template Left Thru Right Leading Detector (ft) 20 100 20 Trailing Detector (ft) 0 0 0 Detector 1 Position(ft) 0 0 0 Detector 1 Size(ft) 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot NA Perm Protected Phases 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2024 Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Detector Phase 5 5 2 2 1 1 6 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 12.0 45.0 Total Split (s) 31.0 31.0 60.0 60.0 18.0 18.0 47.0 47.0 30.0 30.0 41.0 Total Split (%) 20.7% 20.7% 40.0% 40.0% 12.0% 12.0% 31.3% 31.3% 20.0% 20.0% 27.3% Maximum Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 34.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lead Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 24.0 53.0 53.0 11.0 40.0 40.0 23.0 39.7 Actuated g/C Ratio 0.16 0.35 0.35 0.07 0.27 0.27 0.15 0.26 v/c Ratio 1.04 0.83 0.17 1.08 1.18 0.57 1.01 0.59 Control Delay 124.7 49.5 3.3 164.4 138.1 24.0 119.5 49.9 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 124.7 49.5 3.3 164.4 138.1 24.0 119.5 49.9 LOS F D A F F C F D Approach Delay 58.5 122.2 73.2 Approach LOS E F E 90th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 34.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Max 70th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 36.6 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 50th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 39.4 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 30th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 42.2 30th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 10th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 46.3 10th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold Queue Length 50th (ft) ~308 486 0 ~150 ~682 112 ~272 234 Queue Length 95th (ft) #501 549 27 #296 #779 216 #466 313 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 280 1779 638 128 1342 551 268 913 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 1.04 0.83 0.17 1.08 1.18 0.57 1.01 0.59 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2024 Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 4 Lane Group SBL SBT SBR Detector Phase 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 12.0 43.0 43.0 Total Split (s) 31.0 42.0 42.0 Total Split (%) 20.7% 28.0% 28.0% Maximum Green (s) 24.0 35.0 35.0 Yellow Time (s) 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 Recall Mode None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 18.3 35.0 35.0 Actuated g/C Ratio 0.12 0.23 0.23 v/c Ratio 0.78 0.31 1.00 Control Delay 87.7 48.8 70.0 Queue Delay 0.0 0.0 0.0 Total Delay 87.7 48.8 70.0 LOS F D E Approach Delay 67.5 Approach LOS E 90th %ile Green (s) 24.0 35.0 35.0 90th %ile Term Code Max Max Max 70th %ile Green (s) 21.4 35.0 35.0 70th %ile Term Code Gap Max Max 50th %ile Green (s) 18.6 35.0 35.0 50th %ile Term Code Gap Max Max 30th %ile Green (s) 15.8 35.0 35.0 30th %ile Term Code Gap Max Max 10th %ile Green (s) 11.7 35.0 35.0 10th %ile Term Code Gap Max Max Queue Length 50th (ft) 161 108 ~351 Queue Length 95th (ft) 236 151 #608 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 280 817 559 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.60 0.31 1.00 Intersection Summary Lanes, Volumes, Timings 2024 Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 5 Cycle Length: 150 Actuated Cycle Length: 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 150 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.18 Intersection Signal Delay: 84.9 Intersection LOS: F Intersection Capacity Utilization 116.2% ICU Level of Service H Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2024 Build Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 60 30 42 31 47 31 41 Maximum Split (%) 12.0% 40.0% 20.0% 28.0% 20.7% 31.3% 20.7% 27.3% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 84 102 12 42 84 115 12 43 End Time (s) 102 12 42 84 115 12 43 84 Yield/Force Off (s) 95 5 35 77 108 5 36 77 Yield/Force Off 170(s) 95 129 35 48 108 130 36 46 Local Start Time (s) 79 97 7 37 79 110 7 38 Local Yield (s) 90 0 30 72 103 0 31 72 Local Yield 170(s) 90 124 30 43 103 125 31 41 Intersection Summary Cycle Length 150 Control Type Actuated-Coordinated Natural Cycle 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2024 Build Commuter PM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 1 Intersection Int Delay, s/veh 6.8 Movement EBL EBT EBR WBL WBT WBR NBU NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 112 0 58 16 0 57 3 60 534 16 13 49 324 110 Future Vol, veh/h 112 0 58 16 0 57 3 60 534 16 13 49 324 110 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free Free RT Channelized - - None - - None - - - None - - - None Storage Length - - 100 - - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - - 0 - - - 0 - Grade, % - 0 - - 0 - - - 0 - - - 0 - Peak Hour Factor 92 92 92 92 92 92 92 92 92 92 92 92 92 92 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 122 0 63 17 0 62 3 65 580 17 14 53 352 120 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 912 1219 176 1035 1331 299 352 472 0 0 598 597 0 0 Stage 1 486 486 - 725 725 - - - - - - - - - Stage 2 426 733 - 310 606 - - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 6.46 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.53 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 227 178 834 185 152 694 854 1079 - - 596 969 - - Stage 1 529 547 - 380 426 - - - - - - - - - Stage 2 574 422 - 672 483 - - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 185 153 834 153 131 694 1061 1061 - - 834 834 - - Mov Cap-2 Maneuver 185 153 - 153 131 - - - - - - - - - Stage 1 495 503 - 356 399 - - - - - - - - - Stage 2 489 395 - 571 444 - - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 39.9 16.5 0.9 1.2 HCM LOS E C Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 1061 - - 185 834 391 834 - - HCM Lane V/C Ratio 0.065 - - 0.658 0.076 0.203 0.081 - - HCM Control Delay (s) 8.6 - - 55.6 9.7 16.5 9.7 - - HCM Lane LOS A - - F A C A - - HCM 95th %tile Q(veh) 0.2 - - 3.9 0.2 0.7 0.3 - - HCM 6th TWSC 2024 Build Commuter PM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 2 Intersection Int Delay, s/veh 0.4 Movement EBL EBR NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 9 9 11 582 9 388 2 Future Vol, veh/h 9 9 11 582 9 388 2 Conflicting Peds, #/hr 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free RT Channelized - None - None - - None Storage Length 100 0 160 - - - 110 Veh in Median Storage, # 0 - - 0 - 0 - Grade, % 0 - - 0 - 0 - Peak Hour Factor 83 83 83 83 92 83 83 Heavy Vehicles, % 3 3 3 3 3 3 3 Mvmt Flow 11 11 13 701 10 467 2 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 864 234 469 0 701 - 0 Stage 1 487 - - - - - - Stage 2 377 - - - - - - Critical Hdwy 6.86 6.96 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - Follow-up Hdwy 3.53 3.33 2.23 - 2.53 - - Pot Cap-1 Maneuver 291 765 1082 - 512 - - Stage 1 581 - - - - - - Stage 2 660 - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 280 765 1082 - 512 - - Mov Cap-2 Maneuver 280 - - - - - - Stage 1 574 - - - - - - Stage 2 643 - - - - - - Approach EB NB SB HCM Control Delay, s 14.1 0.2 0.2 HCM LOS B Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 1082 - 280 765 - - HCM Lane V/C Ratio 0.012 - 0.039 0.014 - - HCM Control Delay (s) 8.4 - 18.4 9.8 - - HCM Lane LOS A - C A - - HCM 95th %tile Q(veh) 0 - 0.1 0 - - HCM 6th TWSC 2024 Build Commuter PM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 3 Intersection Int Delay, s/veh 65.4 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 13 41 1540 119 1 64 2213 45 37 4 126 6 2 2 65 Future Vol, veh/h 13 41 1540 119 1 64 2213 45 37 4 126 6 2 2 65 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - - None Storage Length - 345 - 180 - 200 - - - - 100 - - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - - 0 - Grade, % - - 0 - - - 0 - - 0 - - - 0 - Peak Hour Factor 92 96 96 96 92 96 96 96 96 96 96 92 96 96 96 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 14 43 1604 124 1 67 2305 47 39 4 131 7 2 2 68 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1717 2352 0 0 1171 1728 0 0 2777 4206 802 0 3223 4307 1176 Stage 1 - - - - - - - - 1718 1718 - 0 2465 2465 - Stage 2 - - - - - - - - 1059 2488 - 0 758 1842 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.16 - 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.93 - 3.83 4.03 3.93 Pot Cap-1 Maneuver 172 81 - - 350 170 - - ~ 20 ~ 2 279 0 10 ~ 2 157 Stage 1 - - - - - - - - 61 142 - 0 17 58 - Stage 2 - - - - - - - - 214 57 - 0 330 123 - Platoon blocked, % - - - - - Mov Cap-1 Maneuver 85 85 - - 170 170 - - ~ 4 0 279 0 ~ 2 0 157 Mov Cap-2 Maneuver - - - - - - - - ~ 4 0 - 0 ~ 2 0 - Stage 1 - - - - - - - - ~ 20 47 - 0 6 35 - Stage 2 - - - - - - - - 69 34 - 0 53 41 - Approach EB WB NB SB HCM Control Delay, s 3.4 1.1 $ 1517.7 237.1 HCM LOS F F Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) 4 279 85 - - 170 - - 2 157 HCM Lane V/C Ratio 10.677 0.47 0.669 - - 0.399 - - 2.083 0.431 HCM Control Delay (s) $ 6093.2 28.9 107.6 - - 39.4 - -$ 3370.5 44.3 HCM Lane LOS F D F - - E - - F E HCM 95th %tile Q(veh) 7.1 2.4 3.2 - - 1.7 - - 1.4 1.9 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2024 Build Commuter PM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 4 Intersection Int Delay, s/veh 1.9 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 0 11 0 1 10 2 0 0 6 0 0 0 Future Vol, veh/h 0 11 0 1 10 2 0 0 6 0 0 0 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 82 82 82 82 82 82 82 82 82 82 82 82 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 0 13 0 1 12 2 0 0 7 0 0 0 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 14 0 0 13 0 0 28 29 13 32 28 13 Stage 1 - - - - - - 13 13 - 15 15 - Stage 2 - - - - - - 15 16 - 17 13 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1598 - - 1599 - - 979 862 1064 973 863 1064 Stage 1 - - - - - - 1005 883 - 1002 881 - Stage 2 - - - - - - 1002 880 - 1000 883 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1598 - - 1599 - - 979 861 1064 966 862 1064 Mov Cap-2 Maneuver - - - - - - 979 861 - 966 862 - Stage 1 - - - - - - 1005 883 - 1002 880 - Stage 2 - - - - - - 1001 879 - 993 883 - Approach EB WB NB SB HCM Control Delay, s 0 0.6 8.4 0 HCM LOS A A Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 1064 1598 - - 1599 - - - HCM Lane V/C Ratio 0.007 - - - 0.001 - - - HCM Control Delay (s) 8.4 0 - - 7.3 - - 0 HCM Lane LOS A A - - A - - A HCM 95th %tile Q(veh) 0 0 - - 0 - - - Lanes, Volumes, Timings 2029 (Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 2 238 1702 284 8 91 647 123 1 214 322 88 Future Volume (vph) 2 238 1702 284 8 91 647 123 1 214 322 88 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 0.95 1.00 0.95 0.95 Frt 0.850 0.850 0.968 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3393 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3393 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 166 210 24 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Adj. Flow (vph) 2 248 1773 296 8 95 674 128 1 223 335 92 Shared Lane Traffic (%) Lane Group Flow (vph) 0 250 1773 296 0 103 674 128 0 224 427 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right R NA Left R NA Right Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 9 15 9 Number of Detectors 1 1 2 1 1 1 2 1 1 1 2 Detector Template Left Left Thru Right Left Left Thru Right Left Left Thru Leading Detector (ft) 20 20 100 20 20 20 100 20 20 20 100 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 20 6 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases 2 6 Lanes, Volumes, Timings 2029 (Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 2 Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 1 214 307 536 Future Volume (vph) 1 214 307 536 Ideal Flow (vphpl) 1900 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 0.95 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 0 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 0 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 314 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.92 0.96 0.96 0.96 Adj. Flow (vph) 1 223 320 558 Shared Lane Traffic (%) Lane Group Flow (vph) 0 224 320 558 Enter Blocked Intersection No No No No Lane Alignment R NA Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 Number of Detectors 1 1 2 1 Detector Template Left Left Thru Right Leading Detector (ft) 20 20 100 20 Trailing Detector (ft) 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot Prot NA Perm Protected Phases 7 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2029 (Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Detector Phase 5 5 2 2 1 1 6 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 12.0 45.0 Total Split (s) 27.0 27.0 48.0 48.0 18.0 18.0 39.0 39.0 35.0 35.0 35.0 Total Split (%) 20.8% 20.8% 36.9% 36.9% 13.8% 13.8% 30.0% 30.0% 26.9% 26.9% 26.9% Maximum Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 28.0 28.0 28.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lead Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 19.7 41.8 41.8 10.2 32.3 32.3 20.9 30.4 Actuated g/C Ratio 0.15 0.32 0.32 0.08 0.25 0.25 0.16 0.23 v/c Ratio 0.94 1.09 0.48 0.75 0.54 0.23 0.80 0.53 Control Delay 97.4 94.2 18.0 90.1 44.3 1.0 72.3 44.3 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 97.4 94.2 18.0 90.1 44.3 1.0 72.3 44.3 LOS F F B F D A E D Approach Delay 84.8 43.4 53.9 Approach LOS F D D 90th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 28.0 28.0 28.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 70th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 23.9 23.9 28.0 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Gap Gap Hold 50th %ile Green (s) 20.0 20.0 41.0 41.0 11.0 11.0 32.0 32.0 21.0 21.0 28.6 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Gap Gap Hold 30th %ile Green (s) 20.0 20.0 41.6 41.6 10.4 10.4 32.0 32.0 18.0 18.0 31.6 30th %ile Term Code Max Max Coord Coord Gap Gap Coord Coord Gap Gap Hold 10th %ile Green (s) 18.4 18.4 44.6 44.6 7.4 7.4 33.6 33.6 13.5 13.5 36.0 10th %ile Term Code Gap Gap Coord Coord Gap Gap Coord Coord Gap Gap Hold Queue Length 50th (ft) 211 ~627 84 86 182 0 184 160 Queue Length 95th (ft) #373 #724 173 #171 225 0 260 217 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 269 1620 617 148 1251 547 377 812 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 0.93 1.09 0.48 0.70 0.54 0.23 0.59 0.53 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2029 (Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 4 Lane Group SBU SBL SBT SBR Detector Phase 7 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 43.0 43.0 Total Split (s) 29.0 29.0 29.0 29.0 Total Split (%) 22.3% 22.3% 22.3% 22.3% Maximum Green (s) 22.0 22.0 22.0 22.0 Yellow Time (s) 4.0 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 Recall Mode None None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 19.6 29.1 29.1 Actuated g/C Ratio 0.15 0.22 0.22 v/c Ratio 0.85 0.41 0.94 Control Delay 81.3 46.3 46.8 Queue Delay 0.0 0.0 0.0 Total Delay 81.3 46.3 46.8 LOS F D D Approach Delay 53.7 Approach LOS D 90th %ile Green (s) 22.0 22.0 22.0 22.0 90th %ile Term Code Max Max Max Max 70th %ile Green (s) 22.0 22.0 26.1 26.1 70th %ile Term Code Max Max Max Max 50th %ile Green (s) 21.4 21.4 29.0 29.0 50th %ile Term Code Gap Gap Max Max 30th %ile Green (s) 18.4 18.4 32.0 32.0 30th %ile Term Code Gap Gap Max Max 10th %ile Green (s) 14.0 14.0 36.5 36.5 10th %ile Term Code Gap Gap Max Max Queue Length 50th (ft) 183 122 230 Queue Length 95th (ft) #299 182 #509 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 296 785 594 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.76 0.41 0.94 Intersection Summary Lanes, Volumes, Timings 2029 (Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 5 Cycle Length: 130 Actuated Cycle Length: 130 Offset: 5 (4%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 140 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.09 Intersection Signal Delay: 66.4 Intersection LOS: E Intersection Capacity Utilization 94.2% ICU Level of Service F Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2029 (Build + 5 Years) AM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 48 35 29 27 39 29 35 Maximum Split (%) 13.8% 36.9% 26.9% 22.3% 20.8% 30.0% 22.3% 26.9% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 76 94 12 47 76 103 12 41 End Time (s) 94 12 47 76 103 12 41 76 Yield/Force Off (s) 87 5 40 69 96 5 34 69 Yield/Force Off 170(s) 87 109 40 40 96 110 34 38 Local Start Time (s) 71 89 7 42 71 98 7 36 Local Yield (s) 82 0 35 64 91 0 29 64 Local Yield 170(s) 82 104 35 35 91 105 29 33 Intersection Summary Cycle Length 130 Control Type Actuated-Coordinated Natural Cycle 140 Offset: 5 (4%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2029 (Build + 5 Years) AM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 1 Intersection Int Delay, s/veh 2.3 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 21 0 16 11 0 55 28 482 15 12 50 553 50 Future Vol, veh/h 21 0 16 11 0 55 28 482 15 12 50 553 50 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free RT Channelized - - None - - None - - None - - - None Storage Length - - 100 - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - 0 - - - 0 - Grade, % - 0 - - 0 - - 0 - - - 0 - Peak Hour Factor 83 83 83 83 83 83 83 83 83 92 83 83 83 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 25 0 19 13 0 66 34 581 18 13 60 666 60 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 1171 1479 333 1137 1530 300 726 0 0 599 599 0 0 Stage 1 812 812 - 658 658 - - - - - - - - Stage 2 359 667 - 479 872 - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 147 123 660 155 115 693 866 - - 595 967 - - Stage 1 337 388 - 417 457 - - - - - - - - Stage 2 629 453 - 534 364 - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 121 108 660 136 101 693 866 - - 851 851 - - Mov Cap-2 Maneuver 121 108 - 136 101 - - - - - - - - Stage 1 324 355 - 401 439 - - - - - - - - Stage 2 547 435 - 474 333 - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 28.7 15.8 0.5 0.9 HCM LOS D C Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 866 - - 121 660 412 851 - - HCM Lane V/C Ratio 0.039 - - 0.209 0.029 0.193 0.086 - - HCM Control Delay (s) 9.3 - - 42.5 10.6 15.8 9.6 - - HCM Lane LOS A - - E B C A - - HCM 95th %tile Q(veh) 0.1 - - 0.7 0.1 0.7 0.3 - - HCM 6th TWSC 2029 (Build + 5 Years) AM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 2 Intersection Int Delay, s/veh 12.4 Movement EBL EBR NBU NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 95 145 2 95 420 7 511 72 Future Vol, veh/h 95 145 2 95 420 7 511 72 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free Free RT Channelized - None - - None - - None Storage Length 100 0 - 160 - - - 110 Veh in Median Storage, # 0 - - - 0 - 0 - Grade, % 0 - - - 0 - 0 - Peak Hour Factor 73 73 92 73 73 92 73 73 Heavy Vehicles, % 3 3 3 3 3 3 3 3 Mvmt Flow 130 199 2 130 575 8 700 99 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 1268 350 700 799 0 575 - 0 Stage 1 716 - - - - - - - Stage 2 552 - - - - - - - Critical Hdwy 6.86 6.96 6.46 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - - Follow-up Hdwy 3.53 3.33 2.53 2.23 - 2.53 - - Pot Cap-1 Maneuver 159 643 513 813 - 616 - - Stage 1 443 - - - - - - - Stage 2 538 - - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver ~ 130 643 799 799 - 616 - - Mov Cap-2 Maneuver ~ 130 - - - - - - - Stage 1 370 - - - - - - - Stage 2 525 - - - - - - - Approach EB NB SB HCM Control Delay, s 65.2 1.9 0.1 HCM LOS F Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 799 - 130 643 - - HCM Lane V/C Ratio 0.166 - 1.001 0.309 - - HCM Control Delay (s) 10.4 - 144.6 13.1 - - HCM Lane LOS B - F B - - HCM 95th %tile Q(veh) 0.6 - 7 1.3 - - Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2029 (Build + 5 Years) AM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 3 Intersection Int Delay, s/veh 14.6 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 3 16 2197 161 5 39 1340 16 20 0 27 7 0 16 Future Vol, veh/h 3 16 2197 161 5 39 1340 16 20 0 27 7 0 16 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - None Storage Length - 345 - 180 - 200 - - - - 100 - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - 0 - Grade, % - - 0 - - - 0 - - 0 - - 0 - Peak Hour Factor 92 95 95 95 92 95 95 95 95 95 95 95 95 95 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 5 3 3 3 Mvmt Flow 3 17 2313 169 5 41 1411 17 21 0 28 7 0 17 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1042 1428 0 0 1688 2482 0 0 3009 3873 1157 2477 4034 714 Stage 1 - - - - - - - - 2353 2353 - 1512 1512 - Stage 2 - - - - - - - - 656 1520 - 965 2522 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.2 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.95 3.83 4.03 3.93 Pot Cap-1 Maneuver 413 240 - - 179 70 - - ~ 14 3 159 31 3 319 Stage 1 - - - - - - - - ~ 21 67 - 86 179 - Stage 2 - - - - - - - - 381 178 - 246 55 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 256 256 - - 75 75 - - ~ 6 1 159 12 1 319 Mov Cap-2 Maneuver - - - - - - - - ~ 6 1 - 12 1 - Stage 1 - - - - - - - - ~ 19 62 - 79 69 - Stage 2 - - - - - - - - 138 68 - 186 51 - Approach EB WB NB SB HCM Control Delay, s 0.2 3.5 $ 995.1 169.7 HCM LOS F F Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) 6 159 256 - - 75 - - 12 319 HCM Lane V/C Ratio 3.509 0.179 0.079 - - 0.62 - - 0.614 0.053 HCM Control Delay (s) $ 2294.6 32.5 20.2 - - 112.3 - -$ 518.9 16.9 HCM Lane LOS F D C - - F - - F C HCM 95th %tile Q(veh) 3.9 0.6 0.3 - - 2.8 - - 1.4 0.2 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2029 (Build + 5 Years) AM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report AM Peak Hour starts at 7:45 am Page 4 Intersection Int Delay, s/veh 13.3 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 1 3 131 155 3 0 37 0 234 0 0 0 Future Vol, veh/h 1 3 131 155 3 0 37 0 234 0 0 0 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 53 53 53 53 53 53 53 53 53 53 53 53 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 2 6 247 292 6 0 70 0 442 0 0 0 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 6 0 0 253 0 0 724 724 130 945 847 6 Stage 1 - - - - - - 134 134 - 590 590 - Stage 2 - - - - - - 590 590 - 355 257 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1608 - - 1306 - - 340 351 917 241 298 1074 Stage 1 - - - - - - 867 784 - 492 493 - Stage 2 - - - - - - 492 493 - 660 693 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1608 - - 1306 - - 281 272 917 103 231 1074 Mov Cap-2 Maneuver - - - - - - 281 272 - 103 231 - Stage 1 - - - - - - 866 783 - 492 383 - Stage 2 - - - - - - 382 383 - 342 692 - Approach EB WB NB SB HCM Control Delay, s 0.1 8.4 22.7 0 HCM LOS C A Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 701 1608 - - 1306 - - - HCM Lane V/C Ratio 0.729 0.001 - - 0.224 - - - HCM Control Delay (s) 22.7 7.2 - - 8.6 - - 0 HCM Lane LOS C A - - A - - A HCM 95th %tile Q(veh) 6.4 0 - - 0.9 - - - Lanes, Volumes, Timings 2030 (Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU Lane Configurations Traffic Volume (vph) 10 268 1338 202 2 118 1335 284 259 277 124 2 Future Volume (vph) 10 268 1338 202 2 118 1335 284 259 277 124 2 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 1.00 0.95 0.95 0.95 Frt 0.850 0.850 0.954 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 1752 3344 0 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 1752 3344 0 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 138 182 44 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.92 Adj. Flow (vph) 11 282 1408 213 2 124 1405 299 273 292 131 2 Shared Lane Traffic (%) Lane Group Flow (vph) 0 293 1408 213 0 126 1405 299 273 423 0 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right Left R NA Right R NA Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 15 9 9 Number of Detectors 1 1 2 1 1 1 2 1 1 2 1 Detector Template Left Left Thru Right Left Left Thru Right Left Thru Left Leading Detector (ft) 20 20 100 20 20 20 100 20 20 100 20 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot NA Prot Protected Phases 5 5 2 1 1 6 3 8 7 Permitted Phases 2 6 Lanes, Volumes, Timings 2030 (Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 2 Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 160 287 525 Future Volume (vph) 160 287 525 Ideal Flow (vphpl) 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 242 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.95 0.95 0.95 Adj. Flow (vph) 168 302 553 Shared Lane Traffic (%) Lane Group Flow (vph) 170 302 553 Enter Blocked Intersection No No No Lane Alignment Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 Turning Speed (mph) 15 9 Number of Detectors 1 2 1 Detector Template Left Thru Right Leading Detector (ft) 20 100 20 Trailing Detector (ft) 0 0 0 Detector 1 Position(ft) 0 0 0 Detector 1 Size(ft) 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot NA Perm Protected Phases 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2030 (Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU Detector Phase 5 5 2 2 1 1 6 6 3 8 7 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 45.0 12.0 Total Split (s) 31.0 31.0 60.0 60.0 18.0 18.0 47.0 47.0 30.0 41.0 31.0 Total Split (%) 20.7% 20.7% 40.0% 40.0% 12.0% 12.0% 31.3% 31.3% 20.0% 27.3% 20.7% Maximum Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 34.0 24.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lag Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 24.0 53.0 53.0 11.0 40.0 40.0 23.0 39.5 Actuated g/C Ratio 0.16 0.35 0.35 0.07 0.27 0.27 0.15 0.26 v/c Ratio 1.05 0.79 0.33 0.98 1.05 0.54 1.02 0.46 Control Delay 125.6 47.5 14.0 143.0 90.2 21.7 121.5 43.7 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 125.6 47.5 14.0 143.0 90.2 21.7 121.5 43.7 LOS F D B F F C F D Approach Delay 55.7 82.7 74.2 Approach LOS E F E 90th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 34.0 24.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Max 70th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 36.3 21.7 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 50th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 39.1 18.9 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 30th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 42.0 16.0 30th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap 10th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 46.1 11.9 10th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Hold Gap Queue Length 50th (ft) ~310 452 50 125 ~545 95 ~282 163 Queue Length 95th (ft) #503 513 118 #263 #642 194 #472 228 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 280 1779 643 128 1342 551 268 913 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 1.05 0.79 0.33 0.98 1.05 0.54 1.02 0.46 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2030 (Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 4 Lane Group SBL SBT SBR Detector Phase 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 12.0 43.0 43.0 Total Split (s) 31.0 42.0 42.0 Total Split (%) 20.7% 28.0% 28.0% Maximum Green (s) 24.0 35.0 35.0 Yellow Time (s) 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 Recall Mode None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 18.5 35.0 35.0 Actuated g/C Ratio 0.12 0.23 0.23 v/c Ratio 0.79 0.37 1.00 Control Delay 88.0 49.8 70.9 Queue Delay 0.0 0.0 0.0 Total Delay 88.0 49.8 70.9 LOS F D E Approach Delay 67.5 Approach LOS E 90th %ile Green (s) 24.0 35.0 35.0 90th %ile Term Code Max Max Max 70th %ile Green (s) 21.7 35.0 35.0 70th %ile Term Code Gap Max Max 50th %ile Green (s) 18.9 35.0 35.0 50th %ile Term Code Gap Max Max 30th %ile Green (s) 16.0 35.0 35.0 30th %ile Term Code Gap Max Max 10th %ile Green (s) 11.9 35.0 35.0 10th %ile Term Code Gap Max Max Queue Length 50th (ft) 164 131 ~351 Queue Length 95th (ft) 241 178 #608 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 280 817 551 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.61 0.37 1.00 Intersection Summary Lanes, Volumes, Timings 2030 (Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 5 Cycle Length: 150 Actuated Cycle Length: 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 150 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.05 Intersection Signal Delay: 69.3 Intersection LOS: E Intersection Capacity Utilization 111.4% ICU Level of Service H Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2030 (Build + 5 Years) School PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 60 30 42 31 47 31 41 Maximum Split (%) 12.0% 40.0% 20.0% 28.0% 20.7% 31.3% 20.7% 27.3% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 84 102 12 42 84 115 12 43 End Time (s) 102 12 42 84 115 12 43 84 Yield/Force Off (s) 95 5 35 77 108 5 36 77 Yield/Force Off 170(s) 95 129 35 48 108 130 36 46 Local Start Time (s) 79 97 7 37 79 110 7 38 Local Yield (s) 90 0 30 72 103 0 31 72 Local Yield 170(s) 90 124 30 43 103 125 31 41 Intersection Summary Cycle Length 150 Control Type Actuated-Coordinated Natural Cycle 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2030 (Build + 5 Years) School PM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 1 Intersection Int Delay, s/veh 36.3 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 149 0 80 3 0 29 56 456 9 26 25 425 145 Future Vol, veh/h 149 0 80 3 0 29 56 456 9 26 25 425 145 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free RT Channelized - - None - - None - - None - - - None Storage Length - - 100 - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - 0 - - - 0 - Grade, % - 0 - - 0 - - 0 - - - 0 - Peak Hour Factor 76 76 76 76 76 76 76 76 76 92 76 76 76 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 196 0 105 4 0 38 74 600 12 28 33 559 191 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 1129 1441 280 1156 1626 306 750 0 0 612 612 0 0 Stage 1 681 681 - 754 754 - - - - - - - - Stage 2 448 760 - 402 872 - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver ~ 158 130 714 150 100 687 848 - - 584 956 - - Stage 1 404 446 - 365 413 - - - - - - - - Stage 2 557 410 - 593 364 - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver ~ 130 109 714 112 84 687 848 - - 720 720 - - Mov Cap-2 Maneuver ~ 130 109 - 112 84 - - - - - - - - Stage 1 369 408 - 333 377 - - - - - - - - Stage 2 480 374 - 463 333 - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 215.6 13.5 1 0.8 HCM LOS F B Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 848 - - 130 714 464 720 - - HCM Lane V/C Ratio 0.087 - - 1.508 0.147 0.091 0.085 - - HCM Control Delay (s) 9.6 - -$ 325.5 10.9 13.5 10.5 - - HCM Lane LOS A - - F B B B - - HCM 95th %tile Q(veh) 0.3 - - 13.6 0.5 0.3 0.3 - - Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2030 (Build + 5 Years) School PM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 2 Intersection Int Delay, s/veh 5.8 Movement EBL EBR NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 69 79 58 447 7 446 50 Future Vol, veh/h 69 79 58 447 7 446 50 Conflicting Peds, #/hr 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free RT Channelized - None - None - - None Storage Length 100 0 160 - - - 110 Veh in Median Storage, # 0 - - 0 - 0 - Grade, % 0 - - 0 - 0 - Peak Hour Factor 65 65 65 65 92 65 65 Heavy Vehicles, % 3 3 3 3 3 3 3 Mvmt Flow 106 122 89 688 8 686 77 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 1224 343 763 0 688 - 0 Stage 1 702 - - - - - - Stage 2 522 - - - - - - Critical Hdwy 6.86 6.96 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - Follow-up Hdwy 3.53 3.33 2.23 - 2.53 - - Pot Cap-1 Maneuver 170 650 839 - 522 - - Stage 1 450 - - - - - - Stage 2 557 - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 148 650 839 - 522 - - Mov Cap-2 Maneuver 148 - - - - - - Stage 1 402 - - - - - - Stage 2 542 - - - - - - Approach EB NB SB HCM Control Delay, s 41.2 1.1 0.1 HCM LOS E Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 839 - 148 650 - - HCM Lane V/C Ratio 0.106 - 0.717 0.187 - - HCM Control Delay (s) 9.8 - 74.8 11.8 - - HCM Lane LOS A - F B - - HCM 95th %tile Q(veh) 0.4 - 4.2 0.7 - - HCM 6th TWSC 2030 (Build + 5 Years) School PM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 3 Intersection Int Delay, s/veh 220.5 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 17 50 1639 195 6 65 2046 54 53 3 139 3 1 3 83 Future Vol, veh/h 17 50 1639 195 6 65 2046 54 53 3 139 3 1 3 83 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - - None Storage Length - 345 - 180 - 200 - - - - 100 - - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - - 0 - Grade, % - - 0 - - - 0 - - 0 - - - 0 - Peak Hour Factor 92 95 95 95 92 95 95 95 95 95 95 92 95 95 95 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 18 53 1725 205 7 68 2154 57 56 3 146 3 1 3 87 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1614 2211 0 0 1259 1930 0 0 2880 4228 863 0 3167 4405 1106 Stage 1 - - - - - - - - 1867 1867 - 0 2333 2333 - Stage 2 - - - - - - - - 1013 2361 - 0 834 2072 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.16 - 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.93 - 3.83 4.03 3.93 Pot Cap-1 Maneuver 197 96 - - 312 134 - - ~ 17 ~ 2 254 0 11 ~ 1 175 Stage 1 - - - - - - - - ~ 48 119 - 0 22 69 - Stage 2 - - - - - - - - 229 66 - 0 296 94 - Platoon blocked, % - - - - - Mov Cap-1 Maneuver 98 98 - - 135 135 - - ~ 2 0 254 0 ~ 1 0 175 Mov Cap-2 Maneuver - - - - - - - - ~ 2 0 - 0 ~ 1 0 - Stage 1 - - - - - - - - ~ 13 33 - 0 6 31 - Stage 2 - - - - - - - - ~ 46 29 - 0 31 26 - Approach EB WB NB SB HCM Control Delay, s 3.8 2 $ 4698.3 $ 366 HCM LOS F F Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) 2 254 98 - - 135 - - 1 175 HCM Lane V/C Ratio 29.474 0.576 0.726 - - 0.555 - - 4.211 0.499 HCM Control Delay (s) $ 16268.7 36.8 105.8 - - 61.1 - -$ 7037.1 44.5 HCM Lane LOS F E F - - F - - F E HCM 95th %tile Q(veh) 9.5 3.3 3.8 - - 2.7 - - 1.5 2.4 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2030 (Build + 5 Years) School PM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report School PM Peak Hour starts at 3:00 pm Page 4 Intersection Int Delay, s/veh 8.8 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 1 17 30 78 14 14 10 2 106 23 0 7 Future Vol, veh/h 1 17 30 78 14 14 10 2 106 23 0 7 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 39 39 39 39 39 39 39 39 39 39 39 39 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 3 44 77 200 36 36 26 5 272 59 0 18 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 72 0 0 121 0 0 552 561 83 681 581 54 Stage 1 - - - - - - 89 89 - 454 454 - Stage 2 - - - - - - 463 472 - 227 127 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1522 - - 1460 - - 443 435 974 363 424 1010 Stage 1 - - - - - - 916 819 - 584 568 - Stage 2 - - - - - - 577 557 - 773 789 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1522 - - 1460 - - 389 375 974 232 365 1010 Mov Cap-2 Maneuver - - - - - - 389 375 - 232 365 - Stage 1 - - - - - - 914 817 - 583 490 - Stage 2 - - - - - - 489 481 - 553 787 - Approach EB WB NB SB HCM Control Delay, s 0.2 5.8 11.6 22.4 HCM LOS B C Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 844 1522 - - 1460 - - 283 HCM Lane V/C Ratio 0.358 0.002 - - 0.137 - - 0.272 HCM Control Delay (s) 11.6 7.4 - - 7.9 - - 22.4 HCM Lane LOS B A - - A - - C HCM 95th %tile Q(veh) 1.6 0 - - 0.5 - - 1.1 Lanes, Volumes, Timings 2029 (Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 1 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 7 304 1572 115 3 142 1684 334 2 285 443 126 Future Volume (vph) 7 304 1572 115 3 142 1684 334 2 285 443 126 Ideal Flow (vphpl) 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 1900 Storage Length (ft) 300 200 350 175 180 0 Storage Lanes 1 1 1 1 1 0 Taper Length (ft) 100 80 100 Lane Util. Factor 0.91 1.00 0.91 1.00 0.91 1.00 0.91 1.00 0.95 1.00 0.95 0.95 Frt 0.850 0.850 0.967 Flt Protected 0.950 0.950 0.950 Satd. Flow (prot) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3389 0 Flt Permitted 0.950 0.950 0.950 Satd. Flow (perm) 0 1752 5036 1568 0 1752 5036 1568 0 1752 3389 0 Right Turn on Red Yes Yes Yes Satd. Flow (RTOR) 131 182 22 Link Speed (mph) 45 45 35 Link Distance (ft) 718 718 508 Travel Time (s) 10.9 10.9 9.9 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Adj. Flow (vph) 7 317 1638 120 3 148 1754 348 2 297 461 131 Shared Lane Traffic (%) Lane Group Flow (vph) 0 324 1638 120 0 151 1754 348 0 299 592 0 Enter Blocked Intersection No No No No No No No No No No No No Lane Alignment R NA Left Left Right R NA Left Left Right R NA Left R NA Right Median Width(ft) 16 16 20 Link Offset(ft) 0 0 0 Crosswalk Width(ft) 16 16 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 1.00 Turning Speed (mph) 9 15 9 9 15 9 9 15 9 Number of Detectors 1 1 2 1 1 1 2 1 1 1 2 Detector Template Left Left Thru Right Left Left Thru Right Left Left Thru Leading Detector (ft) 20 20 100 20 20 20 100 20 20 20 100 Trailing Detector (ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Position(ft) 0 0 0 0 0 0 0 0 0 0 0 Detector 1 Size(ft) 20 20 6 20 20 20 6 20 20 20 6 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Detector 2 Position(ft) 94 94 94 Detector 2 Size(ft) 6 6 6 Detector 2 Type Cl+Ex Cl+Ex Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 0.0 0.0 Turn Type Prot Prot NA Perm Prot Prot NA Perm Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases 2 6 Lanes, Volumes, Timings 2029 (Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 2 Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 177 266 595 Future Volume (vph) 177 266 595 Ideal Flow (vphpl) 1900 1900 1900 Storage Length (ft) 150 0 Storage Lanes 1 1 Taper Length (ft) 90 Lane Util. Factor 1.00 0.95 1.00 Frt 0.850 Flt Protected 0.950 Satd. Flow (prot) 1752 3505 1568 Flt Permitted 0.950 Satd. Flow (perm) 1752 3505 1568 Right Turn on Red Yes Satd. Flow (RTOR) 243 Link Speed (mph) 35 Link Distance (ft) 551 Travel Time (s) 10.7 Peak Hour Factor 0.96 0.96 0.96 Adj. Flow (vph) 184 277 620 Shared Lane Traffic (%) Lane Group Flow (vph) 184 277 620 Enter Blocked Intersection No No No Lane Alignment Left Left Right Median Width(ft) 20 Link Offset(ft) 0 Crosswalk Width(ft) 16 Two way Left Turn Lane Headway Factor 1.00 1.00 1.00 Turning Speed (mph) 15 9 Number of Detectors 1 2 1 Detector Template Left Thru Right Leading Detector (ft) 20 100 20 Trailing Detector (ft) 0 0 0 Detector 1 Position(ft) 0 0 0 Detector 1 Size(ft) 20 6 20 Detector 1 Type Cl+Ex Cl+Ex Cl+Ex Detector 1 Channel Detector 1 Extend (s) 0.0 0.0 0.0 Detector 1 Queue (s) 0.0 0.0 0.0 Detector 1 Delay (s) 0.0 0.0 0.0 Detector 2 Position(ft) 94 Detector 2 Size(ft) 6 Detector 2 Type Cl+Ex Detector 2 Channel Detector 2 Extend (s) 0.0 Turn Type Prot NA Perm Protected Phases 7 4 Permitted Phases 4 Lanes, Volumes, Timings 2029 (Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 3 Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Detector Phase 5 5 2 2 1 1 6 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 10.0 5.0 5.0 10.0 10.0 5.0 5.0 5.0 Minimum Split (s) 12.0 12.0 40.0 40.0 12.0 12.0 39.0 39.0 12.0 12.0 45.0 Total Split (s) 31.0 31.0 60.0 60.0 18.0 18.0 47.0 47.0 30.0 30.0 41.0 Total Split (%) 20.7% 20.7% 40.0% 40.0% 12.0% 12.0% 31.3% 31.3% 20.0% 20.0% 27.3% Maximum Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 34.0 Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 4.0 4.0 4.0 All-Red Time (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 7.0 7.0 7.0 7.0 7.0 Lead/Lag Lead Lead Lag Lag Lead Lead Lag Lag Lead Lead Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 2.0 Recall Mode None None C-Min C-Min None None C-Min C-Min None None None Walk Time (s) 7.0 7.0 7.0 7.0 7.0 Flash Dont Walk (s) 26.0 26.0 25.0 25.0 31.0 Pedestrian Calls (#/hr) 0 0 0 0 0 Act Effct Green (s) 24.0 53.0 53.0 11.0 40.0 40.0 23.0 38.6 Actuated g/C Ratio 0.16 0.35 0.35 0.07 0.27 0.27 0.15 0.26 v/c Ratio 1.16 0.92 0.19 1.18 1.31 0.63 1.12 0.67 Control Delay 156.8 55.9 4.7 192.6 186.6 28.1 145.6 53.1 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 156.8 55.9 4.7 192.6 186.6 28.1 145.6 53.1 LOS F E A F F C F D Approach Delay 68.7 162.5 84.1 Approach LOS E F F 90th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 34.0 90th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Max 70th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 35.0 70th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 50th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 37.9 50th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 30th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 40.9 30th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold 10th %ile Green (s) 24.0 24.0 53.0 53.0 11.0 11.0 40.0 40.0 23.0 23.0 45.1 10th %ile Term Code Max Max Coord Coord Max Max Coord Coord Max Max Hold Queue Length 50th (ft) ~373 561 0 ~176 ~804 144 ~334 267 Queue Length 95th (ft) #572 630 37 #326 #900 258 #527 348 Internal Link Dist (ft) 638 638 428 Turn Bay Length (ft) 300 200 350 175 180 Base Capacity (vph) 280 1779 638 128 1342 551 268 888 Starvation Cap Reductn 0 0 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 0 0 Reduced v/c Ratio 1.16 0.92 0.19 1.18 1.31 0.63 1.12 0.67 Intersection Summary Area Type: Other Lanes, Volumes, Timings 2029 (Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 4 Lane Group SBL SBT SBR Detector Phase 7 4 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 12.0 43.0 43.0 Total Split (s) 31.0 42.0 42.0 Total Split (%) 20.7% 28.0% 28.0% Maximum Green (s) 24.0 35.0 35.0 Yellow Time (s) 4.0 4.0 4.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 Total Lost Time (s) 7.0 7.0 7.0 Lead/Lag Lead Lag Lag Lead-Lag Optimize? Yes Yes Yes Vehicle Extension (s) 2.0 2.0 2.0 Recall Mode None None None Walk Time (s) 7.0 7.0 Flash Dont Walk (s) 29.0 29.0 Pedestrian Calls (#/hr) 0 0 Act Effct Green (s) 19.4 35.0 35.0 Actuated g/C Ratio 0.13 0.23 0.23 v/c Ratio 0.81 0.34 1.12 Control Delay 89.4 49.3 108.0 Queue Delay 0.0 0.0 0.0 Total Delay 89.4 49.3 108.0 LOS F D F Approach Delay 89.8 Approach LOS F 90th %ile Green (s) 24.0 35.0 35.0 90th %ile Term Code Max Max Max 70th %ile Green (s) 23.0 35.0 35.0 70th %ile Term Code Gap Max Max 50th %ile Green (s) 20.1 35.0 35.0 50th %ile Term Code Gap Max Max 30th %ile Green (s) 17.1 35.0 35.0 30th %ile Term Code Gap Max Max 10th %ile Green (s) 12.9 35.0 35.0 10th %ile Term Code Gap Max Max Queue Length 50th (ft) 177 120 ~505 Queue Length 95th (ft) 259 164 #750 Internal Link Dist (ft) 471 Turn Bay Length (ft) 150 Base Capacity (vph) 280 817 552 Starvation Cap Reductn 0 0 0 Spillback Cap Reductn 0 0 0 Storage Cap Reductn 0 0 0 Reduced v/c Ratio 0.66 0.34 1.12 Intersection Summary Lanes, Volumes, Timings 2029 (Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 5 Cycle Length: 150 Actuated Cycle Length: 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Natural Cycle: 150 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.31 Intersection Signal Delay: 108.0 Intersection LOS: F Intersection Capacity Utilization 125.8% ICU Level of Service H Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 Timing Report, Sorted By Phase 2029 (Build + 5 Years) Commuter PM Peak Hour 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 6 Phase Number 1 2 3 4 5 6 7 8 Movement WBL EBT NBL SBT EBL WBT SBL NBT Lead/Lag Lead Lag Lead Lag Lead Lag Lead Lag Lead-Lag Optimize Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None C-Min None None None C-Min None None Maximum Split (s) 18 60 30 42 31 47 31 41 Maximum Split (%) 12.0% 40.0% 20.0% 28.0% 20.7% 31.3% 20.7% 27.3% Minimum Split (s) 12 40 12 43 12 39 12 45 Yellow Time (s) 5 5 4 4 5 5 4 4 All-Red Time (s) 2 2 3 3 2 2 3 3 Minimum Initial (s) 5 10 5 5 5 10 5 5 Vehicle Extension (s) 2 2 2 2 2 2 2 2 Minimum Gap (s) 2 2 2 2 3 2 2 2 Time Before Reduce (s) 0 0 0 0 0 0 0 0 Time To Reduce (s) 0 0 0 0 0 0 0 0 Walk Time (s) 7 7 7 7 Flash Dont Walk (s) 26 29 25 31 Dual Entry No Yes No Yes No Yes No Yes Inhibit Max Yes Yes Yes Yes Yes Yes Yes Yes Start Time (s) 84 102 12 42 84 115 12 43 End Time (s) 102 12 42 84 115 12 43 84 Yield/Force Off (s) 95 5 35 77 108 5 36 77 Yield/Force Off 170(s) 95 129 35 48 108 130 36 46 Local Start Time (s) 79 97 7 37 79 110 7 38 Local Yield (s) 90 0 30 72 103 0 31 72 Local Yield 170(s) 90 124 30 43 103 125 31 41 Intersection Summary Cycle Length 150 Control Type Actuated-Coordinated Natural Cycle 150 Offset: 5 (3%), Referenced to phase 2:EBT and 6:WBT, Start of Yellow Splits and Phases: 1: S. Kimball Avenue/N. Kimball Avenue & FM 1709 HCM 6th TWSC 2029 (Build + 5 Years) Commuter PM Peak Hour 2: S. Kimball Avenue & Kimball Oaks Drwy/Primrose School Drwy 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 1 Intersection Int Delay, s/veh 10.4 Movement EBL EBT EBR WBL WBT WBR NBU NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 121 0 62 18 0 63 3 65 590 18 15 54 358 119 Future Vol, veh/h 121 0 62 18 0 63 3 65 590 18 15 54 358 119 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Stop Stop Stop Stop Stop Stop Free Free Free Free Free Free Free Free RT Channelized - - None - - None - - - None - - - None Storage Length - - 100 - - - - 90 - - - 110 - 115 Veh in Median Storage, # - 0 - - 0 - - - 0 - - - 0 - Grade, % - 0 - - 0 - - - 0 - - - 0 - Peak Hour Factor 92 92 92 92 92 92 92 92 92 92 92 92 92 92 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 132 0 67 20 0 68 3 71 641 20 16 59 389 129 Major/Minor Minor2 Minor1 Major1 Major2 Conflicting Flow All 1008 1348 195 1144 1467 331 389 518 0 0 661 661 0 0 Stage 1 539 539 - 799 799 - - - - - - - - - Stage 2 469 809 - 345 668 - - - - - - - - - Critical Hdwy 7.56 6.56 6.96 7.56 6.56 6.96 6.46 4.16 - - 6.46 4.16 - - Critical Hdwy Stg 1 6.56 5.56 - 6.56 5.56 - - - - - - - - - Critical Hdwy Stg 2 6.56 5.56 - 6.56 5.56 - - - - - - - - - Follow-up Hdwy 3.53 4.03 3.33 3.53 4.03 3.33 2.53 2.23 - - 2.53 2.23 - - Pot Cap-1 Maneuver 193 148 810 154 126 662 809 1037 - - 543 917 - - Stage 1 492 518 - 343 393 - - - - - - - - - Stage 2 541 389 - 641 452 - - - - - - - - - Platoon blocked, % - - - - Mov Cap-1 Maneuver 152 124 810 124 105 662 1020 1020 - - 771 771 - - Mov Cap-2 Maneuver 152 124 - 124 105 - - - - - - - - - Stage 1 456 468 - 318 364 - - - - - - - - - Stage 2 450 361 - 531 408 - - - - - - - - - Approach EB WB NB SB HCM Control Delay, s 68.8 19.4 0.9 1.3 HCM LOS F C Minor Lane/Major Mvmt NBL NBT NBR EBLn1 EBLn2WBLn1 SBL SBT SBR Capacity (veh/h) 1020 - - 152 810 337 771 - - HCM Lane V/C Ratio 0.072 - - 0.865 0.083 0.261 0.097 - - HCM Control Delay (s) 8.8 - - 99.1 9.8 19.4 10.2 - - HCM Lane LOS A - - F A C B - - HCM 95th %tile Q(veh) 0.2 - - 5.9 0.3 1 0.3 - - HCM 6th TWSC 2029 (Build + 5 Years) Commuter PM Peak Hour 3: S. Kimball Avenue & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 2 Intersection Int Delay, s/veh 0.5 Movement EBL EBR NBL NBT SBU SBT SBR Lane Configurations Traffic Vol, veh/h 10 9 12 642 10 427 2 Future Vol, veh/h 10 9 12 642 10 427 2 Conflicting Peds, #/hr 0 0 0 0 0 0 0 Sign Control Stop Stop Free Free Free Free Free RT Channelized - None - None - - None Storage Length 100 0 160 - - - 110 Veh in Median Storage, # 0 - - 0 - 0 - Grade, % 0 - - 0 - 0 - Peak Hour Factor 83 83 83 83 92 83 83 Heavy Vehicles, % 3 3 3 3 3 3 3 Mvmt Flow 12 11 14 773 11 514 2 Major/Minor Minor2 Major1 Major2 Conflicting Flow All 951 257 516 0 773 - 0 Stage 1 536 - - - - - - Stage 2 415 - - - - - - Critical Hdwy 6.86 6.96 4.16 - 6.46 - - Critical Hdwy Stg 1 5.86 - - - - - - Critical Hdwy Stg 2 5.86 - - - - - - Follow-up Hdwy 3.53 3.33 2.23 - 2.53 - - Pot Cap-1 Maneuver 256 739 1039 - 461 - - Stage 1 548 - - - - - - Stage 2 632 - - - - - - Platoon blocked, % - - - Mov Cap-1 Maneuver 244 739 1039 - 461 - - Mov Cap-2 Maneuver 244 - - - - - - Stage 1 541 - - - - - - Stage 2 611 - - - - - - Approach EB NB SB HCM Control Delay, s 15.5 0.2 0.3 HCM LOS C Minor Lane/Major Mvmt NBL NBT EBLn1 EBLn2 SBT SBR Capacity (veh/h) 1039 - 244 739 - - HCM Lane V/C Ratio 0.014 - 0.049 0.015 - - HCM Control Delay (s) 8.5 - 20.5 9.9 - - HCM Lane LOS A - C A - - HCM 95th %tile Q(veh) 0 - 0.2 0 - - HCM 6th TWSC 2029 (Build + 5 Years) Commuter PM Peak Hour 4: Kimball Oaks Drwy/Southlake Corners Drwy & FM 1709 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 3 Intersection Int Delay, s/veh 4 Movement EBU EBL EBT EBR WBU WBL WBT WBR NBL NBT NBR SBU SBL SBT SBR Lane Configurations Traffic Vol, veh/h 15 45 1701 129 1 70 2444 50 39 5 139 7 2 2 72 Future Vol, veh/h 15 45 1701 129 1 70 2444 50 39 5 139 7 2 2 72 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop Stop RT Channelized - - - None - - - None - - None - - - None Storage Length - 345 - 180 - 200 - - - - 100 - - - 100 Veh in Median Storage, # - - 0 - - - 0 - - 0 - - - 0 - Grade, % - - 0 - - - 0 - - 0 - - - 0 - Peak Hour Factor 92 96 96 96 92 96 96 96 96 96 96 92 96 96 96 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 16 47 1772 134 1 73 2546 52 41 5 145 8 2 2 75 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 1896 2598 0 0 1293 1906 0 0 3065 4644 886 0 3557 4752 1299 Stage 1 - - - - - - - - 1898 1898 - 0 2720 2720 - Stage 2 - - - - - - - - 1167 2746 - 0 837 2032 - Critical Hdwy 5.66 5.36 - - 5.66 5.36 - - 6.46 6.56 7.16 - 6.46 6.56 7.16 Critical Hdwy Stg 1 - - - - - - - - 7.36 5.56 - - 7.36 5.56 - Critical Hdwy Stg 2 - - - - - - - - 6.76 5.56 - - 6.76 5.56 - Follow-up Hdwy 2.33 3.13 - - 2.33 3.13 - - 3.83 4.03 3.93 - 3.83 4.03 3.93 Pot Cap-1 Maneuver 136 61 - - 299 138 - - ~ 13 ~ 1 245 0 6 ~ 1 129 Stage 1 - - - - - - - - 45 115 - 0 11 43 - Stage 2 - - - - - - - - 183 41 - 0 295 98 - Platoon blocked, % - - - - - Mov Cap-1 Maneuver 61 61 - - 138 138 - - - 0 245 0 - 0 129 Mov Cap-2 Maneuver - - - - - - - - - 0 - 0 - 0 - Stage 1 - - - - - - - - 45 0 - 0 11 20 - Stage 2 - - - - - - - - ~ 32 19 - 0 - 0 - Approach EB WB NB SB HCM Control Delay, s 7.7 1.6 HCM LOS - - Minor Lane/Major Mvmt NBLn1NBLn2 EBL EBT EBR WBL WBT WBR SBLn1 SBLn2 Capacity (veh/h) - 245 61 - - 138 - - - 129 HCM Lane V/C Ratio - 0.591 1.036 - - 0.536 - - - 0.581 HCM Control Delay (s) - 38.9 240.1 - - 57.9 - - - 65.9 HCM Lane LOS - E F - - F - - - F HCM 95th %tile Q(veh) - 3.4 5 - - 2.6 - - - 2.9 Notes ~: Volume exceeds capacity $: Delay exceeds 300s +: Computation Not Defined *: All major volume in platoon HCM 6th TWSC 2029 (Build + 5 Years) Commuter PM Peak Hour 5: Dawson MS Drwy/Kimball Oaks Drwy & Village Center Drive 07/25/2023 Southlake Floor & Decor Development TIA Report Synchro 11 Report Commuter PM Peak Hour starts at 4:45 pm Page 4 Intersection Int Delay, s/veh 2.1 Movement EBL EBT EBR WBL WBT WBR NBL NBT NBR SBL SBT SBR Lane Configurations Traffic Vol, veh/h 0 11 0 1 11 2 0 0 7 0 0 0 Future Vol, veh/h 0 11 0 1 11 2 0 0 7 0 0 0 Conflicting Peds, #/hr 0 0 0 0 0 0 0 0 0 0 0 0 Sign Control Free Free Free Free Free Free Stop Stop Stop Stop Stop Stop RT Channelized - - None - - None - - None - - None Storage Length 110 - - 146 - - - - - - - - Veh in Median Storage, # - 0 - - 0 - - 0 - - 0 - Grade, % - 0 - - 0 - - 0 - - 0 - Peak Hour Factor 82 82 82 82 82 82 82 82 82 82 82 82 Heavy Vehicles, % 3 3 3 3 3 3 3 3 3 3 3 3 Mvmt Flow 0 13 0 1 13 2 0 0 9 0 0 0 Major/Minor Major1 Major2 Minor1 Minor2 Conflicting Flow All 15 0 0 13 0 0 29 30 13 34 29 14 Stage 1 - - - - - - 13 13 - 16 16 - Stage 2 - - - - - - 16 17 - 18 13 - Critical Hdwy 4.13 - - 4.13 - - 7.13 6.53 6.23 7.13 6.53 6.23 Critical Hdwy Stg 1 - - - - - - 6.13 5.53 - 6.13 5.53 - Critical Hdwy Stg 2 - - - - - - 6.13 5.53 - 6.13 5.53 - Follow-up Hdwy 2.227 - - 2.227 - - 3.527 4.027 3.327 3.527 4.027 3.327 Pot Cap-1 Maneuver 1596 - - 1599 - - 977 861 1064 970 862 1063 Stage 1 - - - - - - 1005 883 - 1001 880 - Stage 2 - - - - - - 1001 879 - 999 883 - Platoon blocked, % - - - - Mov Cap-1 Maneuver 1596 - - 1599 - - 977 860 1064 962 861 1063 Mov Cap-2 Maneuver - - - - - - 977 860 - 962 861 - Stage 1 - - - - - - 1005 883 - 1001 879 - Stage 2 - - - - - - 1000 878 - 991 883 - Approach EB WB NB SB HCM Control Delay, s 0 0.5 8.4 0 HCM LOS A A Minor Lane/Major Mvmt NBLn1 EBL EBT EBR WBL WBT WBR SBLn1 Capacity (veh/h) 1064 1596 - - 1599 - - - HCM Lane V/C Ratio 0.008 - - - 0.001 - - - HCM Control Delay (s) 8.4 0 - - 7.3 - - 0 HCM Lane LOS A A - - A - - A HCM 95th %tile Q(veh) 0 0 - - 0 - - - Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - E - Appendix E – Existing Signal Timing Sheets All Data Report #2 Date/Time: 2023-06-16 14:24:51.620870 Intersection Name: FM1709@ KIMBALL (10/2022) Intersection Alias: FM1709/ KMBL Access Code Connection Method Revision Port 2 Baud Rate Address IP Address GPS Enabled GPS Port 9999 Direct IP 5.2.2 0-1200 1 10.217.131.121:1000 False 8 Access Data Port Configuration Scoot Default Data Spat Data VEHICLE AND PEDESTRIAN TIMES Phase Data Bank 1: Vehicle Basic Timings Misc Timings Pedestrian Timings Phase Min Green Passage Max1 Max2 DMAX DSTP/10 Yel/10 Red/10 Green Delay Yellow Delay Walk Offset Time Walk Offset Mode Bike Green Bike Psg Walk Ped Clr Alt Walk Alt Ped Clr Flash Walk Ext Ped Clr Actuated Rest in Walk 1 5 20 20 35 0 0 50 20 0 0 0 0 0 0 0 0 0 0 False 0 False 2 10 20 50 70 0 0 50 20 0 0 0 0 0 0 7 26 0 0 False 0 False 3 5 20 20 25 0 0 40 30 0 0 0 0 0 0 0 0 0 0 False 0 False 4 5 20 25 34 0 0 40 30 0 0 0 0 0 0 7 29 0 0 False 0 False 5 5 20 20 35 0 0 50 20 0 0 0 0 0 0 0 0 0 0 False 0 False 6 10 20 50 70 0 0 50 20 0 0 0 0 0 0 7 25 0 0 False 0 False 7 5 20 20 25 0 0 40 30 0 0 0 0 0 0 0 0 0 0 False 0 False 8 5 20 25 34 0 0 40 30 0 0 0 0 0 0 7 31 0 0 False 0 False Phase Data Bank 2: Vehicle Basic Timings Misc Timings Pedestrian Timings Phase Min Green Passage Max1 Max2 DMAX DSTP/10 Yel/10 Red/10 Green Delay Yellow Delay Walk Offset Time Walk Offset Mode Bike Green Bike Psg Walk Ped Clr Alt Walk Alt Ped Clr Flash Walk Ext Ped Clr Actuated Rest in Walk 1 5 20 20 35 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 2 10 5 50 70 0 0 40 20 0 0 0 0 0 0 8 26 0 0 False 0 False 3 5 20 20 25 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 4 5 20 25 34 0 0 40 20 0 0 0 0 0 0 11 29 0 0 False 0 False 5 5 20 20 35 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 6 10 5 50 70 0 0 40 20 0 0 0 0 0 0 7 25 0 0 False 0 False 7 5 20 20 25 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 8 5 20 25 34 0 0 40 20 0 0 0 0 0 0 9 31 0 0 False 0 False Phase Data Bank 3: Vehicle Basic Timings Misc Timings Pedestrian Timings Phase Min Green Passage Max1 Max2 DMAX DSTP/10 Yel/10 Red/10 Green Delay Yellow Delay Walk Offset Time Walk Offset Mode Bike Green Bike Psg Walk Ped Clr Alt Walk Alt Ped Clr Flash Walk Ext Ped Clr Actuated Rest in Walk 1 5 20 20 35 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 2 10 5 50 70 0 0 40 20 0 0 0 0 0 0 8 26 0 0 False 0 False Port Baud Rate Data Bits Parity CTS DCD RTS 2 0 0 0 False False False 3 0 0 0 False False False Default Data 3 5 20 20 25 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 4 5 20 25 34 0 0 40 20 0 0 0 0 0 0 11 29 0 0 False 0 False 5 5 20 20 35 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 6 10 5 50 70 0 0 40 20 0 0 0 0 0 0 7 25 0 0 False 0 False 7 5 20 20 25 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 8 5 20 25 34 0 0 40 20 0 0 0 0 0 0 9 31 0 0 False 0 False Phase Data Bank 4: Vehicle Basic Timings Misc Timings Pedestrian Timings Phase Min Green Passage Max1 Max2 DMAX DSTP/10 Yel/10 Red/10 Green Delay Yellow Delay Walk Offset Time Walk Offset Mode Bike Green Bike Psg Walk Ped Clr Alt Walk Alt Ped Clr Flash Walk Ext Ped Clr Actuated Rest in Walk 1 5 20 20 35 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 2 10 5 50 70 0 0 40 20 0 0 0 0 0 0 8 26 0 0 False 0 False 3 5 20 20 25 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 4 5 20 25 34 0 0 40 20 0 0 0 0 0 0 11 29 0 0 False 0 False 5 5 20 20 35 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 6 10 5 50 70 0 0 40 20 0 0 0 0 0 0 7 25 0 0 False 0 False 7 5 20 20 25 0 0 40 20 0 0 0 0 0 0 0 0 0 0 False 0 False 8 5 20 25 34 0 0 40 20 0 0 0 0 0 0 9 31 0 0 False 0 False DENSITY TIMES AND GENERAL/VEHICLE/SEQUENCE CONTROL Phase Data Bank 1: Vehicle Density Timings General Control Miscellaneous Special Sequence Phase Added Initial Max Initial Time B4 Redu Car B4 Redu Time to Redu Min Gap Non-Act Response Veh Recall Recall Delay Ped Recall Ped Recall Delay Non Lock Dual Entr y Last Car Pass Condit Ser vice No Simu Gap Out Omit Minus Yel Omit Call 1 0 0 0 0 0 0 False None 0 None 0 True False False False False 0 0 0 2 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 3 0 0 0 0 0 0 False None 0 None 0 True False False False False 0 0 0 4 0 0 0 0 0 0 False None 0 None 0 True True False False False 0 0 0 5 0 0 0 0 0 0 False None 0 None 0 True False False False False 0 0 0 6 0 0 0 0 0 0 True Min 0 None 0 True True False False False 0 0 0 7 0 0 0 0 0 0 False None 0 None 0 True False False False False 0 0 0 8 0 0 0 0 0 0 False None 0 None 0 True True False False False 0 0 0 Phase Data Bank 2: Vehicle Density Timings General Control Miscellaneous Special Sequence Phase Added Initial Max Initial Time B4 Redu Car B4 Redu Time to Redu Min Gap Non-Act Response Veh Recall Recall Delay Ped Recall Ped Recall Delay Non Lock Dual Entr y Last Car Pass Condit Ser vice No Simu Gap Out Omit Minus Yel Omit Call 1 0 0 0 0 0 0 False None 0 None 0 True False False False False 0 0 0 2 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 4 0 0 0 0 0 0 False None 0 None 0 False True False False False 0 0 0 5 0 0 0 0 0 0 False None 0 None 0 True False False False False 0 0 0 6 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 8 0 0 0 0 0 0 False None 0 None 0 False True False False False 0 0 0 Phase Data Bank 3: Vehicle Density Timings General Control Miscellaneous Special Sequence Phase Added Initial Max Initial Time B4 Redu Car B4 Redu Time to Redu Min Gap Non-Act Response Veh Recall Recall Delay Ped Recall Ped Recall Delay Non Lock Dual Entr y Last Car Pass Condit Ser vice No Simu Gap Out Omit Minus Yel Omit Call 1 0 0 0 0 0 0 False None 0 None 0 True False False False False 0 0 0 2 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 4 0 0 0 0 0 0 False None 0 None 0 False True False False False 0 0 0 5 0 0 0 0 0 0 False None 0 None 0 True False False False False 0 0 0 6 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 8 0 0 0 0 0 0 False None 0 None 0 False True False False False 0 0 0 Phase Data Bank 4: Vehicle Density Timings General Control Miscellaneous Special Sequence Phase Added Initial Max Initial Time B4 Redu Car B4 Redu Time to Redu Min Gap Non-Act Response Veh Recall Recall Delay Ped Recall Ped Recall Delay Non Lock Dual Entr y Last Car Pass Condit Ser vice No Simu Gap Out Omit Minus Yel Omit Call 1 0 0 0 0 0 0 False None 0 None 0 True False False False False 0 0 0 2 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 4 0 0 0 0 0 0 False None 0 None 0 False True False False False 0 0 0 5 0 0 0 0 0 0 False None 0 None 0 True False False False False 0 0 0 6 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 8 0 0 0 0 0 0 False None 0 None 0 False True False False False 0 0 0 Detector Bank: 1 Detector Bank: 2 Detector Bank: 3 Detector Bank: 4 Startup & Misc Vehicle Detector Pedestrian Detector Special Detector Veh Det Assign Phase Mode Switch Phase Extend Delay 1 1 0 0 0.0 0 8 8 0 0 0.0 0 10 2 4 0 0.0 0 12 4 0 0 0.0 0 14 6 4 0 0.0 0 7 7 0 0 0.0 0 6 6 4 0 0.0 0 5 5 0 0 0.0 0 4 4 0 0 0.0 0 3 3 0 0 0.0 0 2 2 4 0 0.0 0 16 8 0 0 0.0 0 18 2 0 0 0.0 0 22 6 0 0 0.0 0 26 2 0 0 0.0 0 30 6 0 0 0.0 0 Vehicle Detector Phase Assignment Ped Det Assign Phase Mode Switch Phase Extend Delay 1 1 1 0 0.0 0 2 2 1 0 0.0 0 3 3 1 0 0.0 0 4 4 1 0 0.0 0 5 5 1 0 0.0 0 6 6 1 0 0.0 0 7 7 1 0 0.0 0 8 8 1 0 0.0 0 Pedestrian Detector Spc Det Assign Phase Mode Switch Phase Extend Delay Special Detector Phase Assignment Veh Det Assign Phase Mode Switch Phase Extend Delay Vehicle Detector Phase Assignment Ped Det Assign Phase Mode Switch Phase Extend Delay Pedestrian Detector Spc Det Assign Phase Mode Switch Phase Extend Delay Special Detector Phase Assignment Veh Det Assign Phase Mode Switch Phase Extend Delay Vehicle Detector Phase Assignment Ped Det Assign Phase Mode Switch Phase Extend Delay Pedestrian Detector Spc Det Assign Phase Mode Switch Phase Extend Delay Special Detector Phase Assignment Veh Det Assign Phase Mode Switch Phase Extend Delay Vehicle Detector Phase Assignment Ped Det Assign Phase Mode Switch Phase Extend Delay Pedestrian Detector Spc Det Assign Phase Mode Switch Phase Extend Delay Special Detector Phase Assignment Startup Time 7 Time In Seconds Remote Flash Overlap Special Ring Output Mapping Configuration Load Switch Red Mode Yellow Mode Green Mode FIO 1 Phase Vehicle 1 Red Phase Vehicle 1 Yellow Phase Vehicle 1 Green 1 2 Phase Vehicle 2 Red Phase Vehicle 2 Yellow Phase Vehicle 2 Green 2 3 Phase Vehicle 3 Red Phase Vehicle 3 Yellow Phase Vehicle 3 Green 3 4 Phase Vehicle 4 Red Phase Vehicle 4 Yellow Phase Vehicle 4 Green 4 5 Phase Vehicle 5 Red Phase Vehicle 5 Yellow Phase Vehicle 5 Green 5 6 Phase Vehicle 6 Red Phase Vehicle 6 Yellow Phase Vehicle 6 Green 6 7 Phase Vehicle 7 Red Phase Vehicle 7 Yellow Phase Vehicle 7 Green 7 Startup State All Red Red Revert 40.0 Time in Tenth Second Auto Pedestrian Clear 0 0-No 1-Yes Stop Time Reset 0 0-No 1-Yes Alternate Sequence 1 00-18 Alt Sequence ## Special Sequence 0 LoadSwitch Flash Alt 1 Red 0 2 Red 1 3 Red 0 4 Red 1 5 Red 0 6 Red 1 7 Red 0 8 Red 1 13 Red 0 14 Red 1 15 Red 0 16 Red 1 Remote Flash Phase Entr y Exit 2 True True 6 True True Flash Entry/Exit Phases Standard FYA Default Data Standard Default Data FYA PED PRI Default Data PED Default Data PRI Phase Ring Next Phase Concur Phases 1 1 2 1, 5, 6 2 1 3 2, 5, 6 3 1 4 3, 7, 8 4 1 1 4, 7, 8 5 2 6 1, 2, 5 6 2 7 1, 2, 6 7 2 8 3, 4, 7 8 2 5 3, 4, 8 8 Phase Vehicle 8 Red Phase Vehicle 8 Yellow Phase Vehicle 8 Green 8 9 Phase Pedestrian 2 Dont Walk Phase Pedestrian 2 Ped Clear Phase Pedestrian 2 Walk 9 10 Phase Pedestrian 4 Dont Walk Phase Pedestrian 4 Ped Clear Phase Pedestrian 4 Walk 10 11 Phase Pedestrian 6 Dont Walk Phase Pedestrian 6 Ped Clear Phase Pedestrian 6 Walk 11 12 Phase Pedestrian 8 Dont Walk Phase Pedestrian 8 Ped Clear Phase Pedestrian 8 Walk 12 13 Overlap A Red Overlap A Yellow Overlap A Green 13 14 Overlap B Red Overlap B Yellow Overlap B Green 14 15 Overlap C Red Overlap C Yellow Overlap C Green 15 16 Overlap D Red Overlap D Yellow Overlap D Green 16 17 Phase Pedestrian 1 Dont Walk Phase Pedestrian 1 Ped Clear Phase Pedestrian 1 Walk 17 18 Phase Pedestrian 3 Dont Walk Phase Pedestrian 3 Ped Clear Phase Pedestrian 3 Walk 18 19 Phase Pedestrian 5 Dont Walk Phase Pedestrian 5 Ped Clear Phase Pedestrian 5 Walk 19 20 Phase Pedestrian 7 Dont Walk Phase Pedestrian 7 Ped Clear Phase Pedestrian 7 Walk 20 21 None None None None None None 21 22 None None None None None None 22 23 None None None None None None 23 24 None None None None None None 24 25 None None None None None None 25 26 None None None None None None 26 27 None None None None None None 27 28 None None None None None None 28 29 None None None None None None 29 30 None None None None None None 30 31 None None None None None None 31 32 None None None None None None 32 Sequence Data Sequence 1 Deafult Data Sequence 2 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 5 6 7 8 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 2 Sequence 3 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 5 6 7 8 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 3 Sequence 4 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 5 6 7 8 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 4 Sequence 5 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 6 5 7 8 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 5 Sequence 6 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 6 5 7 8 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 6 Sequence 7 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 6 5 7 8 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 7 Sequence 8 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 6 5 7 8 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 8 Sequence 9 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 5 6 8 7 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 9 Sequence 10 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 5 6 8 7 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 10 Sequence 11 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 5 6 8 7 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 11 Sequence 12 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 5 6 8 7 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 12 Sequence 13 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 6 5 8 7 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 13 Sequence 14 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 6 5 8 7 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 14 Sequence 15 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 6 5 8 7 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 15 Sequence 16 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 6 5 8 7 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 16 Port 1 and ITS Data Address Device Present Basic Detection Msg 40 Frame Enables 0 True False False 1 True False False 8 True False False 9 True False False 16 True False False 18 True False False I/O Misc ABC Input(Entry) Modes ABC Output(O/STS) Modes D Input(Entry) Modes D Output (O/STS) Modes Aux Switch 0 0 0 0 2 Ring Input Response Output Selection 1 1 1 2 2 2 3 0 0 4 0 0 Peer to Peer Unit Bank: 1 Default Data Unit Bank: 2 Default Data Unit Bank: 3 Default Data Unit Bank: 4 Default Data Coord Data Operation Mode Max Correction Offset Force Max Dwell Yield Period Manual Pattern Auto Perm Yield Inhibit Short Way End Green Plan 0 0 1 Coord Setup Pattern Data 1 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 1 130 0 0 0 0 0 0 5 4 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 18 48 35 29 27 39 29 35 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 2 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 2 130 0 0 0 0 0 0 0 0 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 18 48 35 29 27 39 29 35 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 3 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 3 130 0 0 0 0 0 0 0 0 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 18 48 35 29 27 39 29 35 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 4 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 4 120 0 0 0 0 0 0 75 10 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 19 45 26 30 24 40 30 26 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 5 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 5 120 0 0 0 0 0 0 0 0 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 19 45 26 30 24 40 30 26 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 6 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 6 120 0 0 0 0 0 0 0 0 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 19 45 26 30 24 40 30 26 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 7 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 7 150 0 0 0 0 0 0 3 4 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 18 60 30 42 31 47 31 41 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 8 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 8 150 0 0 0 0 0 0 0 0 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 18 60 30 42 31 47 31 41 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 9 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 9 150 0 0 0 0 0 0 0 0 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 18 60 30 42 31 47 31 41 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 10 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 10 140 0 0 0 0 0 0 55 4 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 16 50 26 48 21 46 26 47 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 11 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 11 140 0 0 0 0 0 0 0 0 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 16 50 26 48 21 46 26 47 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 12 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 12 140 0 0 0 0 0 0 0 0 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 16 50 26 48 21 46 26 47 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 19 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 19 140 0 0 0 0 0 0 45 10 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 22 52 26 40 30 44 30 36 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 20 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 20 140 0 0 0 0 0 0 0 0 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 22 52 26 40 30 44 30 36 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 21 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 21 140 0 0 0 0 0 0 0 0 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 22 52 26 40 30 44 30 36 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Time Based Control Data DST Cycle Zero: 1 day, 0:00 DST Type: 0 TimeZoneDiff: 0 Entry Number Begin Month Begin Occurrences Begin Day Of Week Begin Day Of Month Begin Seconds To Transition End Month End Occurrences End Day Of Week End Day Of Month End Seconds To Transition Seconds To Adjust 1 3 2 1 1 7200 11 1 1 1 7200 3600 2 14 1 1 1 0 1 1 1 1 0 0 DST Schedules Month Day of Month Day of Week Schedule Plan 1 2 3 4 5 6 7 8 9 10 11 12 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 1 2 3 4 5 6 7 1 1 X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X 2 2 X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X 3 3 X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X 4 4 X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X 5 5 X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X 6 6 X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X 7 7 X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X Schedules Day Plans Day Plan 1 Event Hour Minute Action 1 8 0 19 2 20 0 254 Day Plan 1 Day Plan 2 Event Hour Minute Action 1 6 0 1 2 10 0 4 3 15 15 7 4 19 0 254 Day Plan 2 Day Plan 3 Actions Action Pattern Aux1 Aux2 Aux3 SP1 SP2 SP3 SP4 SP5 SP6 SP7 SP8 DIM Det1 Det2 Det3 Ph1 Ph2 Ph3 Ph4 Ph5 Ph6 Ph7 Ph8 Ph9 Ph10 Ph11 Ph12 Ph13 Ph14 Ph15 Ph16 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7 7 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11 11 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 16 16 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19 19 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 22 22 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 25 25 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 37 37 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 254 254 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Actions Dimming Event Hour Minute Action 1 6 0 1 2 10 0 4 3 15 15 7 4 19 0 254 Day Plan 3 Day Plan 4 Event Hour Minute Action 1 6 0 1 2 10 0 4 3 15 15 7 4 19 0 254 Day Plan 4 Day Plan 5 Event Hour Minute Action 1 6 0 1 2 10 0 4 3 15 15 7 4 19 0 254 Day Plan 5 Day Plan 6 Event Hour Minute Action 1 6 0 1 2 10 0 4 3 15 15 7 4 19 0 254 Day Plan 6 Day Plan 7 Event Hour Minute Action 1 8 0 19 2 20 0 254 Day Plan 7 Special Function Maps Default Data Special Function Maps Phase Functions Default Data Phase Functions Default Data Preempt Configuration Preempt Overrides Preempt Overrides 1 2 3 4 5 6 7 8 9 10 11 12 OV Flash 1 1 1 1 1 1 0 0 0 0 0 0 OV PE+1 0 0 0 0 0 0 0 0 0 0 0 0 OV PRI 0 0 0 0 0 0 0 0 0 0 0 0 Preempt Overrides Preempt 1 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK#DURAT GATE R2C 248 0 90 0 0 0 0 0 0 0 0 0 Miscellaneous Inter val Timings MIN GRN MIN WLK DWL GRN EXT PED SEL PED CLR SEL YEL/10 SEL RED/10 TRK GRN TRK PED CLR TRK YEL/10 TRK RED/10 RET PED CLR RET YEL/10 RET RED/10 0 0 5 0 7 40 20 5 0 40 20 0 40 20 Interval Timings Preempt 2 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK#DURAT GATE R2C 249 0 90 0 0 0 0 0 0 0 0 0 Miscellaneous Inter val Timings MIN GRN MIN WLK DWL GRN EXT PED SEL PED CLR SEL YEL/10 SEL RED/10 TRK GRN TRK PED CLR TRK YEL/10 TRK RED/10 RET PED CLR RET YEL/10 RET RED/10 0 0 5 0 7 40 20 5 0 40 20 0 40 20 Exit/Calls Phase Exit Calls 2 1 1 6 1 1 Exit/Calls Vehicle Data Phase Track Green DWELL Cycle 1 1 1 0 6 1 1 0 Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data Overlap Data Phase Track Green DWELL Cycle Trail 1 5 5 0 0 2 0 0 0 0 3 0 0 0 0 4 0 0 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 16 0 0 0 0 Overlap Data Interval Timings Preempt 3 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK#DURAT GATE R2C 250 0 90 0 0 0 0 0 0 0 0 0 Miscellaneous Inter val Timings MIN GRN MIN WLK DWL GRN EXT PED SEL PED CLR SEL YEL/10 SEL RED/10 TRK GRN TRK PED CLR TRK YEL/10 TRK RED/10 RET PED CLR RET YEL/10 RET RED/10 0 0 5 0 7 40 20 5 0 40 20 0 40 20 Interval Timings Exit/Calls Phase Exit Calls 2 1 1 6 1 1 Exit/Calls Vehicle Data Phase Track Green DWELL Cycle 2 1 1 0 5 1 1 0 Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data Overlap Data Phase Track Green DWELL Cycle Trail 1 0 0 0 0 2 0 0 0 0 3 5 5 0 0 4 0 0 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 16 0 0 0 0 Overlap Data Exit/Calls Phase Exit Calls 2 1 1 6 1 1 Exit/Calls Vehicle Data Phase Track Green DWELL Cycle 4 1 1 0 7 1 1 0 Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data Overlap Data Phase Track Green DWELL Cycle Trail 1 0 0 0 0 2 0 0 0 0 3 0 0 0 0 4 0 0 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 Preempt 4 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK#DURAT GATE R2C 251 0 90 0 0 0 0 0 0 0 0 0 Miscellaneous Inter val Timings MIN GRN MIN WLK DWL GRN EXT PED SEL PED CLR SEL YEL/10 SEL RED/10 TRK GRN TRK PED CLR TRK YEL/10 TRK RED/10 RET PED CLR RET YEL/10 RET RED/10 0 0 5 0 7 40 20 5 0 40 20 0 40 20 Interval Timings Preempt 5 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK#DURAT GATE R2C 252 0 0 0 0 0 0 0 0 0 0 0 Miscellaneous Inter val Timings MIN GRN MIN WLK DWL GRN EXT PED SEL PED CLR SEL YEL/10 SEL RED/10 TRK GRN TRK PED CLR TRK YEL/10 TRK RED/10 RET PED CLR RET YEL/10 RET RED/10 0 0 0 0 0 40 20 0 0 40 20 0 40 20 Interval Timings 16 0 0 0 0 Overlap Data Exit/Calls Phase Exit Calls 2 1 1 6 1 1 Exit/Calls Vehicle Data Phase Track Green DWELL Cycle 3 1 1 0 8 1 1 0 Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data Overlap Data Phase Track Green DWELL Cycle Trail 1 0 0 0 0 2 0 0 0 0 3 0 0 0 0 4 0 0 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 16 0 0 0 0 Overlap Data Exit/Calls Default Data Exit/Calls Vehicle Data Default Data Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 Overlap Data Phase Track Green DWELL Cycle Trail 1 0 0 0 0 2 0 0 0 0 3 0 0 0 0 4 0 0 0 0 Preempt 6 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK#DURAT GATE R2C 253 0 0 0 0 0 0 0 0 0 0 0 Miscellaneous Inter val Timings MIN GRN MIN WLK DWL GRN EXT PED SEL PED CLR SEL YEL/10 SEL RED/10 TRK GRN TRK PED CLR TRK YEL/10 TRK RED/10 RET PED CLR RET YEL/10 RET RED/10 0 0 0 0 0 40 20 0 0 40 20 0 40 20 Interval Timings Preempt 7 Data Default Data Preempt 8 Data Default Data Preempt 9 Data Default Data Preempt 10 Data 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 16 0 0 0 0 Overlap Data Exit/Calls Default Data Exit/Calls Vehicle Data Default Data Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data Overlap Data Phase Track Green DWELL Cycle Trail 1 0 0 0 0 2 0 0 0 0 3 0 0 0 0 4 0 0 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 16 0 0 0 0 Overlap Data Default Data Preempt 11 Data Default Data Preempt 12 Data Default Data Priority Priority 1 Deafult Data Priority 2 Deafult Data Priority 3 Deafult Data Priority 4 Deafult Data Priority 5 Deafult Data Priority 6 Deafult Data Priority 7 Deafult Data Priority 8 Deafult Data Priority 9 Deafult Data Priority 10 Deafult Data Priority 11 Deafult Data Priority 12 Deafult Data System/Detector Communications Local Address: 1 Revert to Backup: 900.0 IP Address: 10.217.131.121:1000 System Detector Data Bank 1: Default Data Bank 2: Default Data Bank 3: Default Data Bank 4: Default Data Queue Assignments Bank 1: Default Data Bank 2: Default Data Bank 3: Default Data Bank 4: Default Data Queue Select Bank 1: Default Data Bank 2: Default Data Bank 3: Default Data Bank 4: Default Data System/Detector Data - Detector Diagnostics System Data - Speed Measurement: 0 System Data - Speed Ranges/Pattern Vehicle Detector Diagnostics Value: 0 Default Data Vehicle Detector Diagnostics Value: 0 Vehicle Detector Diagnostics Value: 1 Default Data Vehicle Detector Diagnostics Value: 1 Pedestrian Detector Value: 0 Default Data Pedestrian Detector Value: 0 Pedestrian Detector Value: 1 Default Data Pedestrian Detector Value: 1 Special Detector Diagnostics Value: 0 Default Data Special Detector Diagnostics Value: 0 Special Detector Diagnostics Value: 1 Default Data Special Detector Diagnostics Value: 1 Speed Trap 1 Default Data Speed Trap 1 Speed Trap 2 Default Data Speed Trap 2 Pattern Speed Trap Low Threshold Speed Trap High Threshold Default Data Floor and Decor July 26, 2023 FM 1709 / Kimball Avenue AVO 54063 Southlake, Texas - F - Appendix F – Floor & Decor Trip Generation and Parking Study Excerpts Parking and Trip Generation Study Floor & Decor Prepared for: Centerpoint Integrated Solutions, LLC Prepared by: Kimley-Horn and Associates, Inc. 12740 Gran Bay Parkway West, Suite 2350 Jacksonville, Florida 32258 ©Kimley-Horn and Associates, Inc. February 2023 Parking and Trip Generation Study Floor & Decor Prepared for: Centerpoint Integrated Solutions, LLC Prepared by: Kimley-Horn and Associates, Inc. 12740 Gran Bay Parkway West, Suite 2350 Jacksonville, Florida 32258 ©Kimley-Horn and Associates, Inc. February 2023 This item has been digitally signed and sealed by: on the date adjacent to the signature. Printed copies of this document are not considered signed and sealed and the signature must be verified on any electronic copies Floor & Decor Parking and Trip Generation Study Page i February 2023 TABLE OF CONTENTS Page Introduction .................................................................................................................................1 Data Collection............................................................................................................................1 Results of Parking Data Collection ............................................................................................12 Results of Trip Generation Data Collection ...............................................................................12 Summary ..................................................................................................................................15 Appendix A: Sample Parking and Trip Generation Data Collection Sheets Appendix B: Parking Data Collection Appendix C: Trip Generation Data Collection LIST OF FIGURES Page Figure 1: Doral Store Location Map .............................................................................................3 Figure 2: Alexandria Store Location Map ....................................................................................4 Figure 3: Pompano Beach Store Location Map ...........................................................................5 Figure 4: Farmingdale Store Location Map .................................................................................6 Figure 5: Woodland Hills Store Location Map..............................................................................7 Figure 6: North Charleston Store Location Map ..........................................................................8 Figure 7: Avon Store Location Map .............................................................................................9 Figure 8: Cypress Store Location Map ......................................................................................10 Figure 9: Tuckwila Store Location Map .....................................................................................11 Floor & Decor Parking and Trip Generation Study Page ii February 2023 LIST OF TABLES Page Table 1: Peak Parking Counts and Rates .................................................................................13 Table 2: Peak Hour Trip Generation Summary .........................................................................14 Table 3: Average Parking and Trip Generation Rates ..............................................................15 Table 4: Highest Parking and Trip Generation Rates ................................................................15 Floor & Decor Parking and Trip Generation Study Page 1 February 2023 Introduction Centerpoint Integrated Solutions, L LC has retained Kimley-Horn and Associates, Inc. (Kimley- Horn) to determine actual parking and trip generation rates at several Floor and Decor stores around the country. Due to the characteristics of Floor & Decor’s products, the sizes of the stores are very large in comparison to other retail stores, typically ranging between 60,000 and 100,000 square feet. The stores are sized to accommodate the large amount of flooring inventory that is typically stored and displayed f or sale within the store. Historically, in order to determine the trip generation and required parking for a proposed Floor & Decor store, municipalities have used parking and trip generation rates that are based on studies for more traditional commercial retail stores. These traditional retail rates tend to overestimate the parking spaces needed and the weekday peak hour trips generated by a Floor & Decor store. This can result in Floor & Decor incurring unnecessary costs associated with constructing under -utilized parking lots for its stores or over-assessment for off-site transportation mitigation or mobility fees. Kimley-Horn has recently conducted parking and trip generation data collection for several existing Floor & Decor stores around the country. From the data collection, actual parking and trip generation rates were determined for the existing stores on a per thousand square feet basis. This report summarizes the data collection and resulting parking and trip generation rates . Data Collection Parking and trip generation data was collected for nine existing Floor & Decor stores around the country. These nine sites represent some of the best performing stores in each of their respective markets and were selected for study a s the stores anticipated to have the highest parking and trip generation rates, representing a “worst -case” scenario. The store locations are as follows: 1. Doral: 2525 NW 82nd Avenue; Doral, FL, 33122 2. Alexandria: 4607 Eisenhower Avenue; Alexandria, VA 22304 3. Pompano Beach: 1914 W Atlantic Boulevard; Pompano Beach, FL 33069 4. Farmingdale: 1002 Broad Hollow Road; Farmingdale, NY 11735 5. Woodland Hills: 22840 Victory Boulevard; Woodland Hills, CA 91367 6. North Charleston: 6029 Rivers Avenue; Charleston, SC 29406 7. Avon: 80 Stockwell Drive; Avon, MA 02322 8. Cypress: 20502 Hempstead Road; Houston, TX 77065 9. Tuckwila: 17651 Southcenter Parkway; Tuckwila, WA 98188 Floor & Decor Parking and Trip Generation Study Page 2 February 2023 Figures 1 through 9 provide aerial location exhibits for each of the nine studied Floor & Decor stores. At each of the nine stores, Kimley-Horn staff collected weekday parking and trip generation data between Tuesday, No vember 29, 2022 and Tuesday, December 13, 2022. The weekday parking and trip generation data was collected from 7:00 AM to 9:30 AM and from 4:00 PM to 7:00 PM. Also, parking data collection was collected at the nine stores on either Saturday, December 3, 2022 or Saturday, December 10, 2022 from 11:00 AM to 2:00 PM. According to Floor & Decor, the stores do not typically experience seasonal variations in patronage levels and sales. Therefore, the data collection is anticipated to represent typical store cond itions. In order to conduct the trip generation data collection, a Kimley -Horn staff member stood near the entrance to the Floor & Decor store and observed the parking lot. When a vehicle entered the parking lot and a person or a group of people got out of a vehicle and entered the Floor and Decor store or customer pickup area, this was counted as one inbound vehicle trip. When a person or group of people exiting the Floor & Decor store or customer pickup area got into a vehicle and exited the parking lot, this was counted as one outbound vehicle trip. This trip generation data collection method was used recognizing that several of the studied Floor & Decor stores are within shopping centers having multiple ten ants, and this was the easiest way to isolate trips specifically destined to/from the studied Floor & Decor stores. It should be noted that truck delivery trips to/from the rears/sides of the stores were not quantified as Floor and Decor stated that these trips are minimal, especially during peak hours. Also, there are customer pickup areas at the rear of two of the stores (North Charleston and Cypress) that are not visible from the main entrance. Trips to/from these two customer pickup areas were not quant ified as they are thought to be minimal. Appendix A contains samples of the data collection worksheets used at the nine stores in which data was collected. The parking data collected at each of the nine stores is included in Appendix B, and the trip generation data is included in Appendix C. N STORE LOCATION WOODLAND HILLS, CA 91367 22840 VICTORY BLVD WOODLAND HILLS STORE: AND TRIP GENERATION STUDY FLOOR & DECOR PARKING FIGURE 5FALLBROOK AVEVICTORY BLVD Floor & Decor Parking and Trip Generation Study Page 12 February 2023 Results of Parking Data Collection Table 1 presents the results of the parking data collection. As shown in Table 1, the maximum parking rate in spaces per 1,000 square feet of gross leasable area occurred during the Saturday data collection for all but two stores. The Saturday peak parking rates varied from 0.40 spaces per 1,000 square feet in North Charleston, South Carolina , (the lowest Saturday rate) to 1.03 spaces per 1,000 square feet in Woodland Hills, California (the highest Saturday rate). The average weekday AM peak parking rate for the nine stores was 0.47 spaces per 1,000 square feet. The average weekday PM peak parking rate was 0.4 8 spaces per 1,000 square feet. The average Saturday peak parking rate was 0.64 spaces per 1,000 square feet. Results of Trip Generation Data Collection Table 2 presents the results of the trip generation data collection. As shown in Table 2, the Tuckwila, Washington store experienced the lowest AM peak hour trip generation rate, and the Avon, Massachusetts store experienced the lowest PM peak hour trip generation rate. The Woodland Hills store experienced the highest AM peak hour and the highest PM peak hour trip generation rates. The average AM peak hour trip generation ra te for the nine stores was 0.80 trips per 1,000 square feet (53 percent inbound, 47 percent outbound). The average PM peak hour trip generation rate was 0.77 trips per 1,000 square feet (46 percent inbound, 54 percent outbound). Floor & Decor Parking and Trip Generation Study Page 14 February 2023 Table 2: Peak Hour Trip Generation Summary Date in 2022 Time Period Peak Hour Inbound Trips Outbound Trips Total Trips Trip Generation Rate (Trips per 1,000 SF GLA) Inbound Trip Percentage Outbound Trip Percentage Thur, Dec 1 Weekday AM 7:45 AM to 8:45 AM 32 27 59 0.66 54%46% 89,240 GLA Wed, Nov 30 Weekday PM 4:00 PM to 5:00 PM 28 34 62 0.69 45%55% Tues, Nov 29 Weekday AM 8:30 AM to 9:30 AM 39 39 78 0.84 50%50% 93,398 GLA Tues, Nov 29 Weekday PM 4:00 PM to 5:00 PM 38 42 80 0.86 48%52% Wed, Nov 30 Weekday AM 8:00 AM to 9:00 AM 42 41 83 0.96 51%49% 86,610 GLA Wed, Nov 30 Weekday PM 4:15 PM to 5:15 PM 34 30 64 0.74 53%47% Wed, Nov 30 Weekday AM 8:30 AM to 9:30 AM 30 27 57 0.71 53%47% 80,000 GLA Wed, Nov 30 Weekday PM 5:30 PM to 6:30 PM 23 19 42 0.53 55%45% Wed, Nov 30 Weekday AM 8:30 AM to 9:30 AM 31 27 58 1.10 53%47% 52,619 GLA Wed, Nov 30 Weekday PM 4:15 PM to 5:15 PM 40 48 88 1.67 45%55% Tues, Dec 6 Weekday AM 8:30 AM to 9:30 AM 30 24 54 0.72 56%44% 75,000 GLA Tues, Dec 6 Weekday PM 4:00 PM to 5:00 PM 22 29 51 0.68 43%57% Tues, Dec 6 Weekday AM 8:30 AM to 9:30 AM 31 26 57 0.67 54%46% 84,887 GLA Tues, Dec 6 Weekday PM 4:00 PM to 5:00 PM 19 23 42 0.49 45%55% Wed, Dec 7 Weekday AM 8:30 AM to 9:30 AM 38 35 73 0.97 52%48% 74,880 GLA Wed, Dec 7 Weekday PM 4:00 PM to 5:00 PM 18 29 47 0.63 38%62% Thur, Dec 8 Weekday AM 8:30 AM to 9:30 AM 27 20 47 0.52 57%43% 90,359 GLA Tues, Dec 13 Weekday PM 5:00 PM to 6:00 PM 27 34 61 0.68 44%56% Average AM Peak Hour Trip Generation Rate and Inbound/Outbound Percentage 0.80 Average PM Peak Hour Trip Generation Rate and Inbound/Outbound Percentage 0.77 (53% in, 47% out) (46% in, 54% out) Doral, FL Store Location and Size Alexandria, VA Pompano Beach, FL Farmingdale, NY Woodland Hills, CA North Charleston, SC Cypress, TX Avon, MA Tuckwila, WA Floor & Decor Parking and Trip Generation Study Page 15 February 2023 Summary Table 3 presents the average weekday AM and PM peak parking and trip generation rates as well as the average Saturday peak parking rate for the nine stores. Table 4 presents the highest weekday AM and PM parking and trip generation rates observed as well as the h ighest Saturday parking rate observed for the nine stores. Table 3: Average Parking and Trip Generation Rates Table 4: Highest Parking and Trip Generation Rates Time Period Average Peak Parking Rate (Occupied Spaces per 1,000 SF GLA) Average Peak Hour Trip Generation Rate (Trips Per Hour Per 1,000 SF GLA) Average Peak Hour Inbound Trip Percentage Average Peak Hour Outbound Trip Percentage AM Peak 0.47 0.80 53%47% PM Peak 0.48 0.77 46%54% Saturday Peak 0.64 - AM Peak 0.60 Alexandria 1.10 Woodland Hills 53%47% PM Peak 0.84 Woodland Hills 1.67 Woodland Hills 45%55% Saturday Peak 1.03 Woodland Hills - Location of Store with Highest Parking Rate Location of Store with Highest Trip Generation Rate Highest Parking Rate (Occupied Spaces per 1,000 SF GLA) Highest Trip Generation Rate (Trips Per Hour Per 1,000 SF GLA) Time Period Inbound Trip Percentage at Store with Highest Trip Generation Outbound Trip Percentage at Store with Highest Trip Generation Floor & Decor Parking and Trip Generation Study Appendix A: Sample Parking and Trip Generation Data Collection Sheets Floor & Decor Parking and Trip Generation Study Appendix C: Trip Generation Data Collection Location: Woodland Hills, CA From To Inbound Trips Outbound Trips Total Trips 7:00 AM 7:15 AM 2 1 3 7:15 AM 7:30 AM 5 2 7 7:30 AM 7:45 AM 5 4 9 7:45 AM 8:00 AM 7 5 12 8:00 AM 8:15 AM 6 3 9 8:15 AM 8:30 AM 8 6 14 8:30 AM 8:45 AM 4 8 12 8:45 AM 9:00 AM 9 5 14 9:00 AM 9:15 AM 7 8 15 9:15 AM 9:30 AM 11 6 17 From To Inbound Trips Outbound Trips Total Trips 4:00 PM 4:15 PM 12 7 19 4:15 PM 4:30 PM 9 10 19 4:30 PM 4:45 PM 13 15 28 4:45 PM 5:00 PM 9 12 21 5:00 PM 5:15 PM 9 11 20 5:15 PM 5:30 PM 8 8 16 5:30 PM 5:45 PM 7 11 18 5:45 PM 6:00 PM 3 5 8 6:00 PM 6:15 PM 6 10 16 6:15 PM 6:30 PM 4 7 11 6:30 PM 6:45 PM 7 8 15 6:45 PM 7:00 PM 4 8 12 Total 88 Trips Weekday AM Trip Generation Wednesday, November 30, 2022 Total 58 Trips Weekday PM Trip Generation Wednesday, November 30, 2022 Case No. ZA23-0048 S T A F F R E P O R T September 26, 2023 CASE NO: ZA23-0048 PROJECT: Zoning Change and Concept Plan for 1584 Randol Mill Ave EXECUTIVE SUMMARY: Jose Valverde is requesting approval of a Zoning Change and Concept Plan for 1584 Randol Mill located on a property described as Tract 1B, William Winn Survey Abstract No. 1660, City of Southlake, Tarrant County, Texas and located at 1584 Randol Mill Ave, Southlake, Texas. Current Zoning: “AG” Agricultural District. Requested Zoning: “SF-30” Single Family Residential District. SPIN Neighborhood #5. DETAILS: The purpose of this request is to seek a zoning change and concept plan approval to construct a residential addition on a single tract of land. The applicant is proposing to rezone the property to build an addition to the home. As currently zoned, the property is subject to a maximum lot coverage of 10%. With the proposed addition, the lot coverage would exceed this permitted maximum without the zoning change. ACTION NEEDED: 1) Conduct a Public Hearing 2) Consider 2nd Reading Approval ATTACHMENTS: (A) Background Information (B) Vicinity Map (C) Concept Plan Review Summary No. 2, dated August 23rd, 2023 (D) Surrounding Property Owners Map and Responses (E) Ordinance No. 480-807 Full Size Plans (for Commission and Council members only) PowerPoint Presentation Concept Plan Floor Plan STAFF CONTACT: Peyton Sherman (817) 748-8602 Dennis Killough (817) 748-8072 Case No. Attachment A ZA23-0048 Page 1 BACKGROUND INFORMATION OWNER/APPLICANT: Jose Valverde PROPERTY SITUATION: 1584 Randol Mill Ave, Southlake, TX 76092 LEGAL DESCRIPTION: Tract 1B, William Winn Survey Abstract No. 1660 LAND USE CATEGORY: Low Density Residential CURRENT ZONING: “AG” Agricultural District PROPOSED ZONING: “SF-30” Single Family Residential District HISTORY: The home was constructed in 1971 (TAD). “AG” Agricultural District zoning was approved with the adoption of the Zoning Ordinance No 480 and the official Zoning Map on September 19, 1989. SOUTHLAKE COMPREHENSIVE PLAN: Consolidated Future Land Use Plan The future land use designation for the site is Low Density Residential. Purpose and Definition: Purpose: The purpose of the Low-Density Residential land use category is to promote a neighborhood setting primarily comprised of single-family detached houses. Definition: The Low-Density Residential category is suitable for any single-family detached residential development. Other suitable activities are those permitted in the Public Parks/Open Space and Public/Semi- Public categories previously discussed. The applicant is requesting “SF-30” Single Family Residential District zoning. Though “SF-30” is generally associated with the Medium Density Residential Land Use, the tract is .95 acres and therefore cannot be zoned “SF-1A” Single Family Residential District. There will be no increase in density (one residential unit) and the tract will remain in character with the surrounding properties. Other tracts/lots in the vicinity also have “SF-30” zoning. TREE PRESERVATION: No changes to trees are proposed. UTILITIES: The site is served by an 8” sewer line and an 8” water line. CITIZEN INPUT: Due to the limited scope of this request, this project was not heard at SPIN or by the Corridor Planning Committee. PLANNING AND ZONING COMMISSION: September 7th, 2023; APPROVED (6-0) subject to Staff Report September 1st, 2023, and Concept Plan Review No. 2 dated August 23rd, 2023. Case No. Attachment A ZA23-0048 Page 2 CITY COUNCIL ACTION: September 19, 2023, 1st Reading; APPROVED on consent (7-0). STAFF COMMENTS: Attached is Concept Plan Review Summary No. 2, dated August 23rd, 2023. Case No. Attachment B ZA23-0048 Page 1 VICINITY MAP Case No. Attachment C ZA23-0048 Page 1 CONCEPT PLAN REVIEW SUMMARY Case No.: ZA23-0048 Review: Two Date of Review: 08/23/23 Project Name: Zoning Change and Concept Plan – 1584 Randol Mill Ave APPLICANT: OWNER: Jose Armando Valverde Same 1584 Randol Mill Ave, Southlake TX 76092 Phone: (972) 281-7044 Email: Avalverde@me.com CITY STAFF HAS REVIEWED THE ABOVE REFERENCED PROJECT RECEIVED BY THE CITY ON 08/23/2023 AND WE OFFER THE FOLLOWING STIPULATIONS. THESE STIPULATIONS ARE HEREBY MADE CONDITIONS OF CONCEPT PLAN APPROVAL UNLESS SPECIFICALLY AMENDED BY THE CITY COUNCIL. IF YOU HAVE ANY QUESTIONS OR NEED FURTHER CLARIFICATION, PLEASE CONTACT PEYTON SHERMAN. Planning Review Peyton Sherman Planner Phone: (817) 748-8269 Email: psherman@cityofsouthlake.com 1. Concept Plan site data summary table needs to be completed. Case No. Attachment C ZA23-0048 Page 2 Fire Department Review Kelly Clements Fire Marshal kclements@cityofsouthlake.com (817) 748- 8233 GENERAL COMMENTS: 1. No information provided on the square footage of the residence, unable to perform a complete review. Public Works/Engineering Review Sandra Endy Engineer Sendy@cityofsouthlake.com (817) 748- 8033 GENERAL COMMENTS: No comments. General Informational Comments * The Development Review Committee (DRC) has determined this submittal sufficient for formal submittal to the Planning and Zoning Commission subject to completing the changes noted above. * The applicant has confirmed that the proposed building expansion does not impede upon the site triangle for vehicles on Biltmore Dr looking back at oncoming traffic from Randol Mill Ave. * The applicant should be aware that prior to issuance of a building permit an approved zoning and concept plan must be approved by City Council. * * Denotes Informational Comment * For this review, unless otherwise noted, the above comments pertain to the Concept Plan provided Case No. Attachment D ZA23-0048 Page 1 SURROUNDING PROPERTY OWNERS MAP & RESPONSES SPO # Owner Zoning Physical Address Acreage Response 1 LACAYO, DANIEL J AG 1590 RANDOL MILL AVE 1.08 F 2 KIONI, FRED SF1-A 1615 RANDOL MILL AVE 0.06 NR 3 LACAYO, DANIEL J AG 1594 RANDOL MILL AVE 0.71 NR 4 WU, FANGFANG SF1-A 1595 RANDOL MILL AVE 0.50 NR 5 LACAYO, DANIEL J AG 0.01 F 6 ALBERT, SUZIE SF1-A 1591 RANDOL MILL AVE 0.58 NR 7 KETTERING FAMILY LIVING TRUST AG 1.04 F 8 KETTERING FAMILY LIVING TRUST AG 1580 RANDOL MILL AVE 0.06 F 9 SARAVIA, LESLIE SF1-A 1589 RANDOL MILL AVE 0.45 NR 10 JAMES, SCOTT D RPUD 1324 FANNING ST 0.20 NR 11 BALTES, KELLY C RPUD 1322 FANNING ST 0.12 NR 12 STEFFEN, TIMOTHY SF1-A 1483 BROWN LN 0.56 NR 13 FOUR PEAKS-RM INC RPUD 1316 BILTMORE DR 0.04 NR 14 HAND, TREVOR RPUD 1577 RANDOL MILL AVE 0.54 NR 15 FOUR PEAKS-RM INC RPUD 1317 BILTMORE DR 0.03 NR 16 HALEK, JASON AG 1600 RANDOL MILL AVE 1.71 NR 17 CHAN, AMADA SF1-A 1710 MARANATHA WAY 1.29 NR 18 WEITKAMP, ROBERT AG 1570 RANDOL MILL AVE 1.79 NR 19 BAILEY, H SHEPARD SF1-A 1625 RANDOL MILL AVE 1.12 NR 20 SCOTT SANDLIN HOMES LTD AG 1480 BROWN LN 2.80 NR 1000 ALLEN, JEFFREY R AG 1584 RANDOL MILL AVE 1.19 U F: In Favor O: Opposed To U: Undecided NR: No Response Notices Sent: Twenty-one (21) Responses Received: In Favor: 2* Opposed: Undecided: No Response: *The two forms received in favor constitute the ownership of four tracts of land. 9/5/23, 11:21 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQABaaVYFNE7NLhH8WkcWTspQ…1/2 Online Form Submittal: Planning & Zoning Case Input Form noreply@civicplus.com <noreply@civicplus.com> Tue 9/5/2023 11:05 AM To:Dennis Killough <dkillough@ci.southlake.tx.us>;Jennifer Crosby <jcrosby@cityofsouthlake.com>;Reagan Rothenberger <rrothenberger@ci.southlake.tx.us>;Morgan Barclay <mbarclay@ci.southlake.tx.us>;Melissa Burnett <mburnett@cityofsouthlake.com>;Peyton Sherman <psherman@ci.southlake.tx.us>;Katasha Smithers <ksmithers@ci.southlake.tx.us> Planning & Zoning Case Input Form Project Name 1584 Randol Mill Ave Planning & Zoning Case Number ZA23-0048 Project Location 1584 Randol Mill Ave I am:In Favor Comments / Explanation Field not completed. (Section Break) First Name Steven Last Name Kettering Address 1580 Randol Mill Ave Phone Number (Optional)817-692-6756 City Southlake State TX Zip 76092 Disclaimer This form is to provide feedback on planning & zoning-related requests. Your comments are placed in the related case file as a matter of public record and forwarded to the Planning & Zoning Commission and City Council if action is required by these bodies. Your submission of this form shall not be considered a formal protest under Section 211.006(d) of the Texas Local Government Code unless your signature is uploaded and submitted with this form. ***Please note any forms submitted after four P.M. on the meeting date may not be recorded until the following business day.*** Disclaimer Acknowledgment Yes, I understand 9/5/23, 11:21 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQABaaVYFNE7NLhH8WkcWTspQ…2/2 Signature (For Formal Protests) Notice Response Form.pdf Email not displaying correctly? View it in your browser. 9/8/23, 8:26 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQANm99e4vdIlAmyVu1Ce58YE%3D 1/2 Online Form Submittal: Planning & Zoning Case Input Form noreply@civicplus.com <noreply@civicplus.com> Thu 9/7/2023 7:25 PM To:Dennis Killough <dkillough@ci.southlake.tx.us>;Jennifer Crosby <jcrosby@cityofsouthlake.com>;Reagan Rothenberger <rrothenberger@ci.southlake.tx.us>;Morgan Barclay <mbarclay@ci.southlake.tx.us>;Melissa Burnett <mburnett@cityofsouthlake.com>;Peyton Sherman <psherman@ci.southlake.tx.us>;Katasha Smithers <ksmithers@ci.southlake.tx.us> Planning & Zoning Case Input Form Project Name Zoning change and concept plan Planning & Zoning Case Number ZA23-0048 Project Location 1584 Randol Mill Ave I am:In Favor Comments / Explanation I live next door and have no objections as long as they comply with a good architectural outlook (Section Break) First Name Daniel Last Name Lacayo Address 1590 Randol mill Ave Phone Number (Optional)Field not completed. City Southlake State Tx Zip 76092 Disclaimer This form is to provide feedback on planning & zoning-related requests. Your comments are placed in the related case file as a matter of public record and forwarded to the Planning & Zoning Commission and City Council if action is required by these bodies. Your submission of this form shall not be considered a formal protest under Section 211.006(d) of the Texas Local Government Code unless your signature is uploaded and submitted with this form. ***Please note any forms submitted after four P.M. on the meeting date may not be recorded until the following business day.*** 9/8/23, 8:26 AM Mail - Morgan Barclay - Outlook https://outlook.office.com/mail/inbox/id/AAQkADZiMTZhYzFiLTNjZWYtNGM3Mi1hYTk3LTMxMDc5Mzc4YmFlMwAQANm99e4vdIlAmyVu1Ce58YE%3D 2/2 Disclaimer Acknowledgment Yes, I understand Signature (For Formal Protests) image.jpg Email not displaying correctly? View it in your browser. Case No. Attachment E ZA23-0048 Page 1 CITY OF SOUTHLAKE, TEXAS ORDINANCE NO. 480-807 AN ORDINANCE AMENDING ORDINANCE NO. 480, AS AMENDED, THE COMPREHENSIVE ZONING ORDINANCE OF THE CITY OF SOUTHLAKE, TEXAS; GRANTING A ZONING CHANGE ON A CERTAIN TRACT OR TRACTS OF LAND WITHIN THE CITY OF SOUTHLAKE, TEXAS BEING LEGALLY DESCRIBED AS TRACT 1B, WILLIAM WINN SURVEY ABSTRACT NO. 1660, CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS, AND MORE FULLY AND COMPLETELY DESCRIBED IN EXHIBIT “A” FROM “AG” AGRICULTURAL DISTRICT TO “SF-30” SINGLE FAMILY RESIDENTIAL DISTRICT, AS DEPICTED ON THE APPROVED CONCEPT PLAN ATTACHED HERETO AND INCORPORATED HEREIN AS EXHIBIT “B”, SUBJECT TO THE SPECIFIC REQUIREMENTS CONTAINED IN THIS ORDINANCE; CORRECTING THE OFFICIAL ZONING MAP; PRESERVING ALL OTHER PORTIONS OF THE ZONING ORDINANCE; DETERMINING THAT THE PUBLIC INTEREST, MORALS AND GENERAL WELFARE DEMAND THE ZONING CHANGES AND AMENDMENTS HEREIN MADE; PROVIDING THAT THIS ORDINANCE SHALL BE CUMULATIVE OF ALL ORDINANCES; PROVIDING A SEVERABILITY CLAUSE; PROVIDING FOR A PENALTY FOR VIOLATIONS HEREOF; PROVIDING A SAVINGS CLAUSE; PROVIDING FOR PUBLICATION IN THE OFFICIAL NEWSPAPER; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City of Southlake, Texas is a home rule City acting under its Charter adopted by the electorate pursuant to Article XI, Section 5 of the Texas Constitution and Chapter 9 of the Texas Local Government Code; and, WHEREAS, pursuant to Chapter 211 of the Local Government Code, the City has the authority to adopt a comprehensive zoning ordinance and map regulating the location and use of buildings, other structures and land for business, industrial, residential and other purposes, and to amend said ordinance and map for the purpose of promoting the public health, safety, morals and general welfare, all in accordance with a comprehensive Case No. Attachment E ZA23-0048 Page 2 plan; and, WHEREAS, the hereinafter described property is currently zoned as “AG” SINGLE AGRICULTURAL DISTRICT under the City’s Comprehensive Zoning Ordinance; and, WHEREAS, a change in the zoning classification of said property was requested by a person or corporation having a proprietary interest in said property; and, WHEREAS, the City Council of the City of Southlake, Texas, at a public hearing called by the City Council did consider the following factors in making a determination as to whether these changes should be granted or denied: safety of the motoring public and the pedestrians using the facilities in the area immediately surrounding the sites; safety from fire hazards and damages; noise producing elements and glare of the vehicular and stationary lights and effect of such lights on established character of the neighborhood; location, lighting and types of signs and relation of signs to traffic control and adjacent property; street size and adequacy of width for traffic reasonably expected to be generated by the proposed use around the site and in the immediate neighborhood; adequacy of parking as determined by requirements of this ordinance for off-street parking facilities; location of ingress and egress points for parking and off-street loading spaces, and protection of public health by surfacing on all parking areas to control dust; effect on the promotion of health ad the general welfare; effect on light and air; effect on the over-crowding of the land; effect on the concentration of population, and effect on transportation, water, sewerage, schools, parks and other public facilities; and, WHEREAS, the City Council of the City of Southlake, Texas, further considered among other things the character of the districts and their peculiar suitability for particular uses and the view to conserve the value of the buildings, and encourage the most Case No. Attachment E ZA23-0048 Page 3 appropriate use of the land throughout this City; and, WHEREAS, the City Council of the City of Southlake, Texas, does find that there is a public necessity for the zoning changes, that the public demands them, that the public interest clearly requires the amendments, and that the zoning changes do not unreasonably invade the rights of those who bought or improved property with reference to the classification which existed at the time their original investment was made; and, WHEREAS, the City Council of the City of Southlake, Texas, does find that the changes in zoning lessen the congestion in the streets, helps secure safety from fire, panic, and other dangers, promotes the health and the general welfare, provides adequate light and air, prevents the over-crowding of land, avoids undue concentration of population, and facilitates the adequate provision of transportation, water, sewerage, schools, parks and other public requirements; and, WHEREAS, the City Council of the City of Southlake, Texas, has determined that there is a necessity and need for the changes in zoning and has also found and determined that there has been a change in the conditions of the property surrounding and in close proximity to the tract or tracts of land requested for a change since the tract or tracts of land were originally classified and therefore feels that the respective changes in zoning classification for the tract or tracts of land are needed, are called for, and are in the best interest of the public at large, the citizens of the city of Southlake, Texas, and helps promote the general health, safety and welfare of the community. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS: SECTION 1. Case No. Attachment E ZA23-0048 Page 4 That Ordinance No. 480, the Comprehensive Zoning Ordinance of the City of Southlake, Texas, passed on the 19th day of September, 1989, as originally adopted and amended, is hereby amended so that the permitted uses in the hereinafter described areas be altered, changed and amended as shown and described below: Being described as Tract 1B, William Winn Survey Abstract No. 1660, City of Southlake, Tarrant County, Texas as depicted on the approved Concept Plan attached hereto and incorporated herein as Exhibit “B”, and subject to the following conditions: 1. List any conditions SECTION 2. That the City Manager is hereby directed to correct the Official Zoning map of the City of Southlake, Texas, to reflect the herein changes in zoning. SECTION 3. That in all other respects the use of the tract or tracts of land herein above described shall be subject to all the applicable regulations contained in said Zoning Ordinance and all other applicable and pertinent ordinances for the City of Southlake, Texas. All existing sections, subsections, paragraphs, sentences, words, phrases and definitions of said Zoning Ordinance are not amended hereby, but remain intact and are hereby ratified, verified, and affirmed. SECTION 4. That the zoning regulations and districts as herein established have been made in accordance with the comprehensive plan for the purpose of promoting the health, safety, morals and the general welfare of the community. They have been designed, with respect to both present conditions and the conditions reasonably anticipated to exist in the foreseeable future; to lessen congestion in the streets; to provide adequate light and air; Case No. Attachment E ZA23-0048 Page 5 to prevent over-crowding of land; to avoid undue concentration of population; and to facilitate the adequate provision of transportation, water, sewerage, drainage and surface water, parks and other commercial needs and development of the community. They have been made after a full and complete hearing with reasonable consideration among other things of the character of the district and its peculiar suitability for the particular uses and with a view of conserving the value of buildings and encouraging the most appropriate use of land throughout the community. SECTION 5. That this ordinance shall be cumulative of all other ordinances of the City of Southlake, Texas, affecting zoning and shall not repeal any of the provisions of said ordinances except in those instances where provisions of those ordinances are in direct conflict with the provisions of this ordinance. SECTION 6. That the terms and provisions of this ordinance shall be deemed to be severable and that if the validity of the zoning affecting any portion of the tract or tracts of land described herein shall be declared to be invalid, the same shall not affect the validity of the zoning of the balance of said tract or tracts of land described herein. SECTION 7. Any person, firm or corporation who violates, disobeys, omits, neglects or refuses to comply with or who resists the enforcement of any of the provisions of this ordinance shall be fined not more than Two Thousand Dollars ($2,000.00) for each offense. Each day that a violation is permitted to exist shall constitute a separate offense. SECTION 8. Case No. Attachment E ZA23-0048 Page 6 All rights and remedies of the City of Southlake are expressly saved as to any and all violations of the provisions of Ordinance No. 480, as amended, or any other ordinances affecting zoning which have accrued at the time of the effective date of this ordinance; and, as to such accrued violations and all pending litigation, both civil and criminal, whether pending in court or not, under such ordinances, same shall not be affected by this ordinance but may be prosecuted until final disposition by the courts. SECTION 9. The City Secretary of the City of Southlake is hereby directed to publish the proposed ordinance in its entirety on the City website together with a notice setting out the time and place for a public hearing thereon at least ten (10) days before the second reading of this ordinance, and it this ordinance provides for the imposition of any penalty, fine or forfeiture for any violation of any of its provisions, then the City Secretary shall additionally publish this ordinance in the official City newspaper one time within ten (10) days after passage of this ordinance, as required by Section 3.13 of the Charter of the City of Southlake. SECTION 10. This ordinance shall be in full force and effect from and after its passage and publication as required by law, and it is so ordained. PASSED AND APPROVED on the 1st reading the _____ day of _____, 2023. ________________________________ _ MAYOR ATTEST: Case No. Attachment E ZA23-0048 Page 7 ________________________________ CITY SECRETARY PASSED AND APPROVED on the 2nd reading the _____ day of _______, 2023. ________________________________ MAYOR ATTEST: ________________________________ CITY SECRETARY Case No. Attachment E ZA23-0048 Page 8 Reserved for approved exhibits Zoning Change and Concept Plan for 1584 Randol Mill Ave Item 6C: ZA23-0048 ZA23-0041 APPLICANT/ OWNER: Jose Valverde REQUEST: Zoning Change and Concept Plan on property described as Tract 1B, William Winn Survey Abstract No. 1660, City of Southlake, Tarrant County, Texas and located at 1584 Randol Mill, Southlake TX 76092. LOCATION: 1584 Randol Mill Ave. The applicant is requesting “SF-30” Single Family Residential District zoning. Although “SF-30” is generally associated with the Medium Density Residential Land Use, the tract is .95 acres and therefore cannot be zoned “SF-1A” Single Family Residential District. There will be no increase in density (one residential unit) and the tract will remain in character with the surrounding properties. Aerial View Current Survey N Proposed Addition Additions Proposed Concept Plan N Additions N Proposed Concept Plan Additions View Looking North View Looking West PLANNING AND ZONING COMMISSION ACTION: September 7, 2023; APPROVED (6-0), subject to Staff Report dated September 1, 2023, and Zoning Change and Concept Plan Review Summary No. 2 dated August 23, 2023. CITY COUNCIL ACTION, 1st Reading: September 19, 2023; APPROVED ON CONSENT (7-0). Surrounding Property Owner Responses For: Opposed: Undecided: Within 300’ Questions? Dennis Killough (817) 748-8072 RANDOL M I L L A V E BROWN LNBILTMORE DR1591 1595 1584 1577 1483 1589 1590 1615 1570 1580 1600 1710 1322 1317 1564 1594 1316 1 6 3 78 5 2 4 15 1312 9 14 11 10 1000 Vicinity Map ZA23-0048 ® 0 170 34085 Feet 1584 Randol Mill Ave Legend Address Points City Parcels Right Of Way City Limit Case Parcel(s) 200 Foot Buffer 300 Foot Buffer Parcels Within Buffer Data Land Size 41,533 sqft Land Coverage 6,583 sqft 15.85% Proposed SqFt 5,962 sqft Proposed Living sqft 5,042 sqft ZA23-0048 Current Survey Land Size 41,533 sqft Current Setbacks East (Front) 94.6’ Current Setbacks West (Back) 64.0’ Current Setbacks South(Front) 76.7’ Current Setbacks North(Side) 55.3’ ZA23-0048 Survey (with additions) Land Size 41,533 sqft Proposed Setbacks East (Front) 40.5’ Proposed Setbacks West (Back) 55.0’ Proposed Setbacks South(Front) 37.5’ Proposed Setbacks North(Side) 25.3’ ZA23-0048 .EGA. DESCRIPT04 PRC�ECT HlF,-fhUTC'M -ROM ELE ADNIESS I&Rz ZAVML MU AVE Lot, 5.00K COEst FOP1AAMOt,,' lotat"4 I - 'DEED 7AMF". DATt - --------------- II III II II �I II 20' SIDEYARD, SETBACK w nS 3 5' FFZC)Nr,,ARD SE T t"AL k R A D 0 L M L V ZA23-0048 20' SIDEYARD, SETBACK w nS 3 5' FFZC)Nr,,ARD SE T t"AL k R A D 0 L M L V ZA23-0048 Item 4G Item 6D Page 1 of 2 M E M O R A N D U M (October 3, 2023) To: Shana Yelverton, City Manager From: Rob Cohen, Director of Public Works Subject: Approve Ordinance No. 1278, 2nd reading, dedicating a sanitary sewer easement and a temporary construction easement to Trinity River Authority (TRA) on Lot 30, Block 1, Kirkwood Hollow Addition, being located at 3000 N. White Chapel Blvd. Action Requested: Approve Ordinance No. 1278, 2nd reading, dedicating a sanitary sewer easement and a temporary construction easement to Trinity River Authority (TRA) on Lot 30, Block 1, Kirkwood Hollow Addition, being located as 3000 N. White Chapel Blvd. Background Information: TRA is requesting that the City dedicate a sanitary sewer easement for a proposed 30-inch sanitary sewer pipe and a temporary construction easement within Lot 30 Block 1 of the Kirkwood Hollow Addition. The easements will be located within the northmost portion of the City property adjacent to the TRA property and will encompass approximately 0.021-acre and 0.039 acre respectively. TRA is preparing for the necessary improvements on its Denton Creek Pressure System (DCPS) that provides sanitary sewer services to the cities of Roanoke and Southlake, and the town of Westlake. The proposed improvements will increase the pumping capacity of TRA’s Kirkwood Lift Station to meet anticipated flow conditions in the DCPS). The proposed easements are located on City Park property and will require approval from the City Park Board. The easements were approved by the Park Board on September 11, 2023. The easement area to be dedicated does not contain City infrastructure and will not affect access to City infrastructure. Financial Considerations: Applicant has provided the City with the filing fee costs. Strategic Link: This item links to the City’s Strategy Map strategic focus areas are Partnership & Volunteerism. It specifically relates to the Critical Item 6D Page 2 of 2 Business Outcome is, B2: Collaborating with select partners to implement service solutions. Citizen Input/ Board Review: None. Legal Review: The City Attorney has reviewed the ordinance. Alternatives: The City Council may approve or deny the ordinance. Staff Recommendation: Approve Ordinance No. 1278, 2nd reading, dedicating a sanitary sewer easement and a temporary construction easement to Trinity River Authority (TRA) on Lot 30, Block 1, Kirkwood Hollow Addition, being located as 3000 N. White Chapel Blvd. Supporting Documents: Attachment A: Location Map Attachment B: Ordinance No. 1238 Attachment C: Easement Documents Staff Contact: Rob Cohen, Public Works Director Kevin Ferrer, P.E., Deputy City Engineer Sandy Endy, P.E., Development Engineer Location Map Proposed Easement location Approve Ordinance No. 1278, 2nd reading, dedicating a sanitary sewer easement and a temporary construction easement to Trinity River Authority (TRA) on Lot 30, Block 1, Kirkwood Hollow Addition, being located as 3000 N. White Chapel Blvd. Item 6D Requested Action Approve Ordinance No. 1278, 2nd reading, dedicating a sanitary sewer easement and a temporary construction easement to Trinity River Authority (TRA) on Lot 30, Block 1, Kirkwood Hollow Addition, being located as 3000 N. White Chapel Blvd. Location Map Proposed Easement location Background Sabre Dr Proposed Easement location Existing Easement location Proposed Easement location Proposed Temporary Easement location Proposed Temporary Easement location Funding FY 2023 No Cost Agreement Questions? Rob Cohen (817) 748-8097 Ordinance No. 1278 1 ORDINANCE NO. 1278 AN ORDINANCE DEDICATING A PERMANENT SANITARY SEWER EASEMENT FOR A SANITARY SEWER LINE AND ACROSS A PORTION OF CITY OWNED PROPERTY AT THE KIRKWOOD HOLLOW ADDITION. BEING ALL THAT TRACT OF LAND IN THE CITY OF SOUTHLAKE, TARRANT, COUNTY TEXAS A PART OF LOT 30, BLOCK 1, KIRKWOOD HOLLOW PHASE II, AN ADDITION OF THE CITY OF SOUTHLAKE RECORDED IN CABINET A, SLIDE 6044 AND 6045, P.R.T.C.T; DECLARING THAT SUCH EASEMENT IS NECESSARY FOR USE BY THE PUBLIC; AUTHORIZING THE MAYOR TO EXECUTE THE EASEMENT DEDICATION DOCUMENTS; PROVIDING A SEVERABILTY CLAUSE; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City of Southlake, Texas (“the City”) is a home rule city acting under its power adopted by the electorate pursuant to Article XI, Section 5 of the Texas Constitution and Chapter 9 of the Local Government Code; and WHEREAS, the City Council of the City of Southlake, after careful study and consideration, has determined that granting a utility easement of 0.021 acres, located in the City of Southlake, is necessary for installation and maintenance of a sanitary sewer line to be constructed to the benefit of the public and dedicated to the public; and WHEREAS, the City Council of the City of Southlake has determined that there is a public need for a 20-foot permanent sanitary sewer easement across City owned property at Lot 30, Block 1, Kirkwood Hollow Addition. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS: SECTION 1 A 0.021 acre permanent sanitary sewer easement located on the Kirkwood Hollow Addition in the City of Southlake, more specifically described in the county records in D200176846. The easement records attached hereto and incorporated herein for all purposes and the easement is dedicated to the public in perpetuity. SECTION 2 Ordinance No. 1278 2 The Mayor of the City of Southlake, Texas, is hereby authorized and empowered to execute the aforementioned Permanent Sanitary Sewer Easement to permit the construction of a sanitary sewer water line. SECTION 3 A copy of the Permanent Sanitary Sewer Easement shall be presented for filing with the County Clerk of Tarrant County, Texas by the office of the City Secretary. SECTION 4 It is hereby declared to be the intention of the City Council that the phrases, clauses, sentences, paragraphs and sections of this ordinance are severable, and if any phrase, clause, sentence, paragraph or section of this ordinance shall be declared unconstitutional by the valid judgment or decree of any court of competent jurisdiction, such unconstitutionality shall not affect any of the remaining phrases, clauses, sentences, paragraphs and sections of this ordinance, since the same would have been enacted by the City Council without the incorporation in this ordinance of any such unconstitutional phrase, clause, sentence, paragraph or section. SECTION 5 This Ordinance shall be in full force and effect from and its passage, and it so ordained. Ordinance No. 1278 3 PASSED AND APPROVED ON FIRST READING ON THIS ____ DAY OF __________________, 2023. _____________________________ MAYOR ATTEST: ______________________________ CITY SECRETARY PASSED AND APPROVED ON SECOND READING ON THIS ____ DAY OF _________________, 2023. ______________________________ MAYOR ATTEST: ______________________________ CITY SECRETARY EFFECTIVE:______________________________ APPROVED AS TO FORM AND LEGALITY: _________________________________ CITY ATTORNEY Page 1 of 3 TRINITY RIVER AUTHORITY OF TEXAS PERMANENT SANITARY SEWER AND TEMPORARY CONSTRUCTION EASEMENT THE STATE OF TEXAS § § COUNTY OF TARRANT § That I, City of Southlake, GRANTOR herein, for and in consideration of the sum of Ten ($10.00) Dollars and other good and valuable consideration in hand paid by Trinity River Authority of Texas, a conservation and reclamation district created by and functioning under Chapter 518, Acts of the 54th Legislature of the State of Texas, Regular Session, 1955, as amended, GRANTEE herein, the receipt and sufficiency of which is hereby acknowledged and confessed, do hereby grant, sell and convey unto the said GRANTEE a permanent and perpetual easement for the purpose of installing, repairing, maintaining, altering, replacing, relocating, rebuilding, removing, and operating sanitary sewer facilities in, into, upon, over, across, under and through all that land in Tarrant County Texas described as follows, to- wit: A 20-foot wide Permanent Sanitary Sewer Easement containing approximately 0.021 acres through Block 1, Lot 30 of the Kirkwood Hollow Addition, with property address of 3000 N. White Chapel Boulevard, and as more particularly described in Exhibit “A”, and shown on Exhibit “B” attached hereto and incorporated herein. together with the right of ingress and egress as necessary for such purposes; and a temporary workspace easement extending from said permanent easement to the centerline of roadway to accommodate movement of equipment for handling and placement of sanitary sewer improvements, but only as may be necessary during initial construction. The temporary workspace easement shall be in effect during initial construction of sanitary sewer improvements and shall expire upon final acceptance of the initial construction by the City, and further activities limited to the permanent sanitary sewer easement of record. GRANTOR covenants and agrees that GRANTOR and GRANTOR’s heirs, representatives, successors and assigns shall at no time erect, place or construct, or cause to be erected, placed or constructed in, into, upon, over, across or under any easements granted herein any temporary or permanent structures, and it is further agreed that GRANTEE shall have the right to excavate and fill upon said permanent easement and to remove from said permanent easement, any fences, buildings or other obstructions as may now be found upon said permanent easement. Page 2 of 3 It is further intended that the Permanent Sanitary Sewer Easement herein granted to the GRANTEE shall run with the land and forever be a right in and to the land belonging to GRANTOR, and GRANTOR’S successors and assigns, and said grant is expressly excepted from any right of reversion of said premises under any prior deeds in GRANTOR’s chain of title. The Permanent Sanitary Sewer Easement, rights and privileges granted therein are exclusive, and GRANTOR covenants that it will not convey any other easement or conflicting rights within the area covered by the grant to any other person. IN WITNESS WHEREOF, this dedication instrument is executed this , 20 . BY: GRANTOR BY: GRANTOR day of ACKNOWLEDGEMENT THE STATE OF TEXAS, COUNTY OF BEFORE ME, the undersigned authority in and for Tarrant County, Texas, on this day personally appeared known to me or proved to me through (description of identity card or other document) to be the same person whose name is subscribed to the foregoing instrument and acknowledged to me that he/she executed the same for the purposes and consideration therein expressed and in the capacity therein stated. GIVEN UNDER MY HAND AND SEAL OF OFFICE, this day of , 20 . NOTARY SEAL Notary Public, State of Texas Notary’s Name (Printed) Notary’s Commission Expires Page 3 of 3 CERTIFICATE OF ACCEPTANCE This is to certify that the interest and real property conveyed by this dedication instrument the day of , 20 , from to the CITY OF SOUTHLAKE, has been duly accepted subject to all terms and conditions contained therein, and the City Council has consented to recordation of such dedication instrument by its duly authorized officer. Dated SEAL Mayor, CITY OF SOUTHLAKE ATTEST: City Secretary EXHIBIT "A" DENTON CREEK REGIONAL WASTEWATER SYSTEM DENTON CREEK PRESSURE SYSTEM FORCE MAIN AND LIFT STATION IMPROVEMENTS PERMANENT SANITARY SEWER EASEMENT REESE D. PRICE SURVEY, ABSTRACT NO. 1207 LOT 30, BLOCK 1, KIRKWOOD HOLLOW PHASE II CITY OF SOUTHLAKE TARRANT COUNTY, TEXAS PARCEL NO. 2 Being a permanent sanitary sewer easement situated in the Reese D. Price Survey, Abstract No. 1207, City of Southlake, Tarrant County, Texas, and being a portion of Lot 30, Block 1 of Kirkwood Hollow Phase II, an addition to the City of Southlake as recorded in Instrument No. D200176846 of the Official Public Records of Tarrant County, Texas, said Lot 30 being dedicated to the City of Southlake as recorded in Instrument No. D200176846 of said Official Public Records of Tarrant County, Texas, said permanent sanitary sewer easement being more particularly described by metes and bounds as follows: BEGINNING at a calculated point in the west line of said Lot 30 and in the east line of Lot 4R1, Block 1 of the Sabre Group Campus, an addition to the City of Southlake as recorded in Cabinet A, Slide 12216 of the Plat Records of Tarrant County, Texas, said calculated point having a grid coordinate of N=7,043,098.14 and E=2,380,186.43, from which a 5/8 inch iron rod with cap illegible) found for the northwest corner of said Lot 30 bears North 05 degrees 35 minutes 05 seconds East, a distance of 16.91 feet, said 5/8 inch iron rod with cap (illegible) being the southwest corner of a called 0.300 acre tract of land conveyed to the Trinity River Authority of Texas as recorded in Instrument No. D212158243 of said Official Public Records of Tarrant County, Texas; THENCE North 90 degrees 00 minutes 00 seconds East, a distance of 44.00 feet to a calculated point for corner in the west line of a 20' Utility Easement recorded in Volume 13218, Page 339 of said Official Public Records of Tarrant County, Texas; THENCE South 00 degrees 33 minutes 13 seconds East, with the west line of said 20' Utility Easement, a distance of 20.00 feet to a calculated point for corner; THENCE North 90 degrees 00 minutes 00 seconds West, a distance of 46.15 feet to a calculated point for corner in the west line of said Lot 30 and the east line of said Lot 4R1, from which a 5/8 inch iron rod with cap stamped "HUITT ZOLLARS" found for corner in the west line of said Lot 30 and in the east line of said Lot 4R1 bears South 05 degrees 35 minutes 05 seconds West, a distance of 160.86 feet, said 5/8 inch iron rod with cap stamped "HUITT ZOLLARS" being the north corner of Lot 3, Block 1 of Sabre Group Campus, an addition to the City of Southlake as recorded in Cabinet A, Slide 7212 of said Plat Records of Tarrant County, Texas; THENCE North 05 degrees 35 minutes 05 seconds East, with the west line of said Lot 30 and with the east line of said Lot 4R1, a distance of 20.10 feet to the POINT OF BEGINNING, and containing 902 square feet or 0.021 acres of land, more or less. Exhibit"A") Page 1 of 4 GORRONDONA&ASSOCIATES,INC. 2800 N E LOOP 820,SUITE 660 FORT WORTH,TEXAS 73718 817-496-1424 FAX 817-496-1768 Notes: 1.) An exhibit of the same date herewith accompanies this legal description. 2.) All bearings and coordinates are referenced to the Texas State Plane Coordinate System, NAD-83(2011), North Central Zone (4202). All distances and areas shown are surface utilizing a surface adjustment factor of 1.00012. SURVEYOR'S CERTIFICATE * TO ALL PARTIES INTERESTED IN TITLE TO THE PREMISES SURVEYED, I DO HEREBY CERTIFY THAT THE ABOVE LEGAL DESCRIPTION WAS PREPARED FROM PUBLIC RECORDS AND FORM AN ACTUAL AND ACCURATE SURVEY UPON THE GROUNDS AND THAT SAME IS TRUE AND CORRECT. May 30, 2023 Revised July 20, 2023 OF RICH RD KENNEDY > Richard Kennedy 1; °FE ss o''O/ Registered Professional Land\ egR\I Texas No. 5527 Gorrondona &Associates, Inc. Texas Firm No. 10106900 Exhibit "A") Page 2 of 4 GORRONDONA&ASSOCIATES,INC. 2800 N E LOOP 820,SUITE 660 FORT WORTH.TEXAS 73718 817-496-1424 FAX 817-496-1768 PLAT OF EXHIBIT "A " I I I I SURVEYW\ A85 RAcO NO 95 8 CALLED 51.4 ACRES OAA85 RAoj trIN\00- NO 4 TRACT C-259 I I I UNITED STATES OF AMERICA VOLUME 2332, PACE 169 I I O.P.R.T.C.T.\ 5_ 5_ C I FND 5/8'1R I W/CAP STAMPED-I r HUITT ZOLLARS' I II/ I 1 L/-1--- I I EASEMENT AND RIGHT-OF-WAY y L 19 X \` TRINITY RNER AUTHORITY OF TEXAS 1 III - L 1\ INST. NO. D212153806 I h0 r O.P.R.T.C.T. FND 5/8'IR J \D I 'HUITT ZOLLARS. x CALLED 0.300 ACRES ` I `\ TRINITY RIVER AUTHORITY \ FND 5/8'IR OF TEXAS 1 00 50 0 100 T{.0 \ W/CAP INST. NO. D212158243 ILLEGIBLE.O.P R.T.C.T I P.O.B. 4 SCALE IN FEET Lp >\\ / GRID COORDINATE 1 G. 0\ N=7,043,098.14 CALLED 34.5 ACRESa 9`\ E=2,380,186.43 TRACT C-246 S o'G+C,\ io L ' \ UNITED STATES OF AMERICA I B \ SEE 9,p /- \ VOLUME 2297, PAGE 24 q qr. \ b I 41 `` \ O.P.R.T.C.T. 90 \\ I DETAIL "A" <c" o I I s, A3 \\ 20' UT1LI Y EASEMENT t ` INDEg OF o i -+-1 If VOLUME 13218, PAGE 339 y MA oC I OBEM4R1HLCAMPUS \OVERFLOW EASEMENT DEDICATED TO THE • \* '9 VOLUMET4558,CPAGE 505 CITY OF SOUTHLAKE 9J SAHgE\N g S°T al \ZZ\6FND 5/8'IR ` I O.P.R.T.C.T. INST. NO. D200176846 Cr.,- p.R W/CAP STAMPED \ I I I O.P.R.T.C.T. HUITT ZOLLLARS' A I I\ LOT 30, BLOCK 1 r S KIRKWOOD HOLLOW// o o ry \\ ; PHASE II OVERFLOW EASEMENT\_/\ 6‘ V Cj TRACT NO. C-206tJ4., I INST. NO. D200176846 VOLUME 2793, PAGE 55 i " w Q yJ I O.P.R.T.C.T. I O.P.R.T.C.T.E SUR y0 Q i I REESESRAC R NO• 120 I I ABS n, I iuIl TRINITY RIVER AUTHORITY OF TEXAS REVISED JULY 20, 2023 5300 SOUTH COLLINS • P. 0. BOX 60 • ARLINGTON, TEXAS 76004 DENTON CREEK REGIONAL WASTEWATER SYSTEM DENTON CREEK PRESSURE SYSTEM OF \\ FORCE MAIN AND LIFT STATION IMPROVEMENTS r •••••••'•'••• F PERMANENT SANITARY SEWER EASEMENT r Q" 0\;9e,j111\ OWNER: CITY OF SOUTHLAKE 4 RICHARD KENNEDY SURVEY: REESE D. PRICE SURVEY, ABSTRACT NO. 1207 1 <•:° p 5527 Pam'SUBDIVISION: LOT 30, BLOCK 1, KIRKWOOD HOLLOW PHASE II 9 ••••bp 0•' 6 / LOCATION: CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS O• x, . ACQUISITION AREA: 902 SQ.FT. OR 0.021 ACRES 5-- j a WHOLE PROPERTY ACREAGE: 223,512 SQ.FT. OR 5.131 ACRES BY PLAT' RICHARD KENNEDYGSAJOBNO. GARV1901.00 DRAWN BY: RK CAD FILE: UNSAVED DRAWING1.DWG REGISTERED PROFESSIONAL LAND SURVEYOR DATE: MAY 30, 2023 EXHIBIT A PAGE 3 OF 4 SCALE: 1- = 100' NO. 5527 TEXAS FIRM No. 10106900 GORRONDONA & ASSOCIATES, INC. • 2800 N.E. LOOP 820, SUITE 660 FORT WORTH, TX. 76137 • 817-496-1424 FAX 817-496-1768 PLAT OF EXHIBIT "A " LEGEND O SET 5/8" IRON ROD WITH CAP STAMPED GORRONDONA AND ASSOCIATES, INC." FND MONUMENTATION (SIZE AND TYPE NOTED) O CALCULATED POINT LINE TABLE LINE BEARING DISTANCE PROPERTY/RIGHT-OF-WAY LINE L-1 N 05'35'05"E 16.91' L-2 N 90'00'00"E 44.00' EXISTING EASEMENT LINE L-3 S 00'33'13"E 20.00' L-4 N 90'00'00"W 46.15' SURVEY/ABSTRACT LINE L-5 N 05'35'05"E 20.10' INST. NO. INSTRUMENT NO. O.P.R.T.C.T. OFFICIAL PUBLIC RECORDS OF TARRANT COUNTY, TEXAS P.R.T.C.T. PLAT RECORDS OF TARRANT COUNTY, TEXAS P.O.B POINT OF BEGINNING CALLED 0.300 ACRES TRINITY RNER AUTHORITY FND 5/81R OF TEXAS W/CAP INST. NO. D212158243 ILLEGIBLE"Thk, 0.P.R.T.C.T I I I P.O.B. L-2 41) mo GRID COORDINATE .' (() I f u N=7,043,098.14 I I p a PERMANENT E=2,380,186.43 W SANITARY SEWER EASEMENT L-4 i "LOT 30 LOT 4RI LOT 30 1 DETAIL "A" NOT TO SCALE NOTES: 1. A LEGAL DESCRIPTION OF SAME DATE HEREWITH ACCOMPANIES THIS PLAT. 2. ALL BEARINGS AND COORDINATES ARE REFERENCED TO THE TEXAS STATE PLANE COORDINATE SYSTEM, NAD-83,(2011), NORTH CENTRAL ZONE (4202). ALL DISTANCES AND AREAS SHOWN ARE WHOLE PROPERTY MAP ANDSURFACEUTILIZINGASURFACEADJUSTMENTFACTOROF1.00012. LOCATION OF EASEMENT t a TRINITY RIVER AUTHORITY OF TEXAS REVISED JULY 20, 2023 5300 SOUTH COLLINS • P. 0. BOX 60 • ARLINGTON, TEXAS 76004 DENTON CREEK REGIONAL WASTEWATER SYSTEM DENTON CREEK PRESSURE SYSTEM c OF j - FORCE MAIN AND LIFT STATION IMPROVEMENTS A P .................. PERMANENT SANITARY SEWER EASEMENT AA(,,,'- DrFp'\J OWNER: CITY OF SOUTHLAKE 4 RICHARD KENNEDY jSURVEY: REESE D. PRICE SURVEY, ABSTRACT NO. 1207 P 5527 :_ e SUBDIVISION: LOT 30, BLOCK 1, KIRKWOOD HOLLOW PHASE II OF 0<4•''0 LOCATION: CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS O\. RJ/ACQUISITION AREA: 902 SQ.FT. OR 0.021 ACRES WHOLE PROPERTY ACREAGE: 223,512 SQ.FT. OR 5.131 ACRES BY PLAT RICHARD KENNEDY GdrAl JOB NO. GARV1901.00 DRAWN BY: RI< CAD FILE: UNSAVED DRAWING1.DWG REGISTERED PROFESSIONAL LAND SURVEYOR DATE: MAY 30, 2023 EXHIBIT A PAGE 4 OF 4 SCALE: 1' = 100' NO. 5527 TEXAS FIRM No. 10106900 GORRONDONA do ASSOCIATES, INC. • 2800 N.E. LOOP 820, SUITE 660 FORT WORTH, TX. 76137 • 817-496-1424 FAX 817-496-1768 EXHIBIT "B" DENTON CREEK REGIONAL WASTEWATER SYSTEM DENTON CREEK PRESSURE SYSTEM FORCE MAIN AND LIFT STATION IMPROVEMENTS TEMPORARY CONSTRUCTION EASEMENT REESE D. PRICE SURVEY, ABSTRACT NO. 1207 LOT 30, BLOCK 1, KIRKWOOD HOLLOW PHASE II CITY OF SOUTHLAKE TARRANT COUNTY, TEXAS PARCEL NO. 2 PART ONE Being a temporary construction easement situated in the Reese D. Price Survey, Abstract No. 1207, City of Southlake, Tarrant County,Texas, and being a portion of Lot 30, Block 1 of Kirkwood Hollow Phase II, an addition to the City of Southlake as recorded in Instrument No. D200176846 of the Official Public Records of Tarrant County, Texas, said Lot 30 being dedicated to the City of Southlake as recorded in Instrument No. D200176846 of said Official Public Records of Tarrant County, Texas, said temporary construction easement being more particularly described by metes and bounds as follows: BEGINNING at a 5/8 inch iron rod with cap (illegible) found for the northwest corner of said Lot 30 and the southwest corner of a called 0.300 acre tract of land conveyed to the Trinity River Authority of Texas as recorded in Instrument No. D212158243 of said Official Public Records of Tarrant County, Texas, said 5/8 inch iron rod with cap (illegible) being in the west line of said Lot 30 and in the east line of Lot 4R1, Block 1 of the Sabre Group Campus, an addition to the City of Southlake as recorded in Cabinet A, Slide 12216 of the Plat Records of Tarrant County, Texas, said calculated point having a grid coordinate of N=7,043,114.97 and E=2,380,188.08; THENCE North 89 degrees 23 minutes 47 seconds East, with the north line of said Lot 30 and the south line of said called 0.300 acre tract of land, a distance of 42.19 feet to a calculated point for the northwest corner of a 20' Utility Easement recorded in Volume 13218, Page 339 of said Official Public Records of Tarrant County, Texas; THENCE South 00 degrees 33 minutes 13 seconds East, with the west line of said 20' Utility Easement, a distance of 17.28 feet to a calculated point for northeast corner of a Permanent Sanitary Sewer Easement as shown in Exhibit "A"; THENCE North 90 degrees 00 minutes 00 seconds West, with the north line of said Permanent Sanitary Sewer Easement, a distance of 44.00 feet to a calculated point for southwest corner of said Permanent Sanitary Sewer Easement, said calculated point being in the west line of said Lot 30 and in the east line of said 4R1, from which a 5/8 inch iron with cap stamped "HUITT ZOLLARS" found for the north corner of Lot 3, Block 1 of Sabre Group Campus, an addition to the City of Southlake as recorded in Cabinet A, Slide 7212 of said Plat Records of Tarrant County, Texas bears South 05 degrees 35 minutes 05 seconds West, a distance of 180.96 feet, said 5/8 inch iron rod with cap stamped HUITT ZOLLARS" being in the west line of said Lot 30 and in the east line of said Lot 4R1; Exhibit"B") Page 1 of 6 GORRONDONA&ASSOCIATES,INC. 2800 N E LOOP 820,SUITE 660 FORT WORTH,TEXAS 73718 817-496-1424 FAX 817-496-1768 THENCE North 05 degrees 35 minutes 05 seconds East, with the west line of said Lot 30 and with the east line of said Lot 4R1, a distance of 16.91 feet to the POINT OF BEGINNING, and containing 735 square feet or 0.017 acres of land, more or less. PART TWO Being a temporary construction easement situated in the Reese D. Price Survey, Abstract No. 1207, City of Southlake, Tarrant County,Texas, and being a portion of Lot 30, Block 1 of Kirkwood Hollow Phase II, an addition to the City of Southlake as recorded in Instrument No. D200176846 of the Official Public Records of Tarrant County, Texas, said Lot 30 being dedicated to the City of Southlake as recorded in Instrument No. D200176846 of said Official Public Records of Tarrant County,Texas, said temporary construction easement being more particularly described by metes and bounds as follows: BEGINNING at a calculated point in the west line of said Lot 30 and the east line of Lot 4R1, Block 1 of the Sabre Group Campus, an addition to the City of Southlake as recorded in Cabinet A, Slide 12216 of the Plat Records of Tarrant County, Texas, said calculated point being the southwest corner of a Permanent Sanitary Sewer Easement as shown in Exhibit "A", said calculated point having a grid coordinate of N=7,043,078.14 and E=2,380,184.47, from which a 5/8 inch iron rod with cap (illegible) found for the northwest corner of said Lot 30 bears North 05 degrees 35 minutes 05 seconds East, a distance of 37.01 feet, said 5/8 inch iron rod with cap illegible) being the southwest corner of a called 0.300 acre tract of land conveyed to the Trinity River Authority of Texas as recorded in Instrument No. D212158243 of said Official Public Records of Tarrant County, Texas; THENCE North 90 degrees 00 minutes 00 seconds East, with the south line of said Permanent Sanitary Sewer Easement, a distance of 46.15 feet to a calculated point for the southeast corner of said Permanent Sanitary Sewer Easement, said calculated point being in the west line of a 20' Utility Easement recorded in Volume 13218, Page 339 of said Official Public Records of Tarrant County, Texas; THENCE South 00 degrees 33 minutes 13 seconds East, with the west line of said 20' Utility Easement, a distance of 20.00 feet to a calculated point for corner; THENCE North 90 degrees 00 minutes 00 seconds West, a distance of 48.30 feet to a calculated point for corner in the west line of said Lot 30 and the east line of said Lot 4R1, from which a 5/8 inch iron rod with cap stamped "HUITT ZOLLARS" found for the north corner of Lot 3, Block 1 of Sabre Group Campus, an addition to the City of Southlake as recorded in Cabinet A, Slide 7212 of said Plat Records of Tarrant County, Texas bears South 05 degrees 35 minutes 05 seconds West, a distance of 140.77 feet, said 5/8 inch iron rod with cap stamped "HUITT ZOLLARS" being in the west line of said Lot 30 and in the east line of said Lot 4R1; THENCE North 05 degrees 35 minutes 05 seconds East, with the west line of said Lot 30 and the east line of said Lot 4R1, a distance of 20.10 feet to the POINT OF BEGINNING, and containing 945 square feet or 0.022 acres of land, more or less. Exhibit"B") Page 2 of 6 GORRONDONA 8 ASSOCIATES,INC. 2800 N E LOOP 820,SUITE 660 FORT WORTH,TEXAS 73718 817-496-1424 FAX 817-496-1768 Notes: 1.) An exhibit of the same date herewith accompanies this legal description. 2.) All bearings and coordinates are referenced to the Texas State Plane Coordinate System, NAD-83(2011), North Central Zone (4202). All distances and areas shown are surface utilizing a surface adjustment factor of 1.00012. SURVEYOR'S CERTIFICATE * TO ALL PARTIES INTERESTED IN TITLE TO THE PREMISES SURVEYED, I DO HEREBY CERTIFY THAT THE ABOVE LEGAL DESCRIPTION WAS PREPARED FROM PUBLIC RECORDS AND FORM AN ACTUAL AND ACCURATE SURVEY UPON THE GROUNDS AND THAT SAME IS TRUE AND CORRECT. June 21, 2023 Revised June 22, 2023 Revised July 20, 2023 OF T S TfR.... RICH A RD KENNEDY 7 Ct' Richard Kennedy I;FEss..o? -..Or Registered Professional Land`:,-,- egcj.R l , Texas No. 5527 Gorrondona &Associates, Inc. Texas Firm No. 10106900 Exhibit "B") Page 3 of 6 GORRONDONA&ASSOCIATES,INC. 2800 N E LOOP 820,SUITE 660 FORT WORTH,TEXAS 73718 817-496-1424 FAX 817-496-1768 PLAT OF EXHIBIT ''B '' PART ONE I I I N MEO°\0 505sY I I OO\3ZHs 5 4gY W\1504 00S 1V CALLED 51.4 ACRES DAv\SSRAO 4 0 I AB TRACT C-259 I I p'8 UNITED STATES OF AMERICAI VOLUME 2332, PAGE 169 I I O.P.R.T.C.T. cy cy C FND 5/8'IR I r W/CAP STAMPED-I / HUITT ZOLLARS' 1 I I 11-f-1--- I A\\ EA EMENCEL 19AND RIGHT-OF-WAY TRINITY RIVER AUTHORITY OF TEXAS L INST. NO. 0212153806 r O.P.R.T.C.T. y `FND AMPED 1 W/CAP STAMPEDj\......,./..--..\(S 5 \ 1 'HUITT ZOLLARS- CALLED 0.300 ACRES \ TRINITY RIVER AUTHORITY \ FND 5/8'IR OF TEXAS 1 00 50 0 1 00 fo \\ W/CAP INST. NO. D212158243 \ ILLEGIBLE'N n O.P R.T.C.T JY P.O.B.f---SCALE IN FEET p $4y\\ / GRID COORDINATE 6 P1' \/ N=7,043,114.97 DIN ACRES T C-246E=2,380,188.08 r` ' \ UNITED STATES F AMERICA 144 SEE 9 ,( \ VOLUME 2297, PAGE 24 O 9 4, \ a8p 1 9 c` \ O.P.R.T.C.T. qP `'A\ DETAIL "A' m„, oJ I 1 0y \ ti A h I 20' UTILITY EASEMENT G,y MAINDEROCK pk F~ 0.P.RATC T. E 13218, PAGE 339 O Lpq' 4R1' p CAM\6US \\\ N \\ OVERTRACLOWT EASEMENTASEMEN DEDICATED TO THE \\\``909.0 GR 1DE. 12 VOLUME 4558, PAGE 505 CITY OF SOUTHLAKESAB2560REP, soDE.FND 5/8"IR \ i O.P.R.T.C.T. INST. NO. D200176846 cM3- p.Rt' • W/CAP STAMPED \ I \\ I I O.P.R.T.C.T. l HUM" ZOLLARS' A V!! I 6 N.O 7,41. \ LOT 30, BLOCK > KIRKWOOD HOLLOW Z 0r ti \\ ; PHASE II OVERFLOW EASEMENT 7 TRACT NO. C-206 V J I INST. NO. D200176846 VOLUME 2793, PAGE 55 RVEY w 4 yJ4• i i O.P.R.T.C.T. i o.P.R.T.C.T. PR\CE SO 0 \ ti 5 2 a I v RE ABSSRACj N. I t TRINITY RIVER AUTHORITY OF TEXAS REVISED JUNE 22, 2023 5300 SOUTH COLLINS • P. 0. BOX 60 • ARLINGTON, TEXAS 76004 REVISED JULY 20, 2023 DENTON CREEK REGIONAL WASTEWATER SYSTEM DENTON CREEK PRESSURE SYSTEM OFMIFORCEMAINANDLIFTSTATIONIMPROVEMENTS1,Q *SrFRF. \ TEMPORARY CONSTRUCTION EASEMENT - PART ONE r v1 OWNER: CITY OF SOUTHLAKE 4 RICHARD KENNEDY ') SURVEY: REESE D. PRICE SURVEY, ABSTRACT NO. 1207 p 5527 <' t SUBDIVISION: LOT 30, BLOCK 1, KIRKWOOD HOLLOW PHASE II 9 F 0''O LOCATION: CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS 0 R, \ACQUISITION AREA: 735 SQ.FT. OR 0.017 ACRES i WHOLE PROPERTY ACREAGE: 223,512 SQ.FT. OR 5.131 ACRES BY PLAT' G&AI JOB NO. GARV1901.00 DRAWN BY: RK CAD FILE: TCE-01E-R02.DWG RICHARD KENNEDDYY REGISTERED PROFESSIONAL LAND SURVEYOR DATE: JUNE 21, 2023 EXHIBIT B PAGE 4 OF 6 SCALE: 1- = 100' NO. 5527 TEXAS ARM No. 10106900 GORRONDONA & ASSOCIATES. INC. • 2800 N.E. LOOP 820, SUITE 660 FORT WORTH, TX. 76137 • 817-496-1424 FAX 817-496-1768 PLAT OF EXHIBIT ''B '' PART TWO I As.004 5A958' I I 101 SVA.48`( W\ABS RACS Np CALLED 51.4 ACRES 0Pk\i DO Np. I TRACT C-259 I I UNITED STATES OF AMERICA I VOLUME 2332, PAGE 169 I I O.P.R.T.C.T. 5_ 5_ 5_ FND 5/8)R r / i \ W/CAP STAMPED I HUITT ZOLLARS' I II/ I I fl--- I ilEASEMENTANDRIGHT-OF-WAY 5C TRINCEL 19 RY RNER AUTHORTY OF TEXAS / - L INST. NO. D212153806 r O.P.R.T.C.T. JI. FND 5/8'IR 0 \ W/CAP STAMPED 5° \ l 'HUITT ZOLLARS' A X.CALLED 0.300 ACRES \ TRINITY RNER AUTHORITY \ FND 5/81R OF TEXAS 1 00 50 0 100 f \\ W/CAP INST. NO. D212158243 ILLEGIBLE'\ O.Py-P R.T.C.T T— s P.O.B. SCALE IN FEET z8 ' \\ / GRID COORDINATE G.; Ta\/ N=7,043,078.14 CALLED 34.5 ACRES oa 9\\ E=2,380,184.47 TRACT C-246 i UNITED STATES OF AMERICA 1 v1 4 \\ N. S E E L9 ^ \ VOLUME 2297, PAGE 24 1, *q\\\ 1 DETAIL B ` 'm Pfo,)` 1 I o 'S' of 9AC` \\ h 20' UTILITY EASEMENT C AIN° OF 1 pr - `~VOLUO.P.RATCT. E 13218. PAGE 339 q, REM g1, p CAMPUS \1 OVERFLOW EASEMENT DEDICATED TO THE \ \`9090LOTOUpZ\6 TRACT N0. C-2560 J Gg 2 VOLUME 4558, PAGE 505 CITY OF SOUTHLAKE • gE SL\OE O.P.R.T.C.7. INST. NO. D200176846SABE( A, j FND 5/8'IR \ I CPB\N p.Rj.• W/CAP STAMPED 1 I I O.P.R.T.C.T. HUITT ZOLLARS' \ 1 I I 1 I I I 60 \NI j<LOT 30, BLOCK 1 ro KIRKWOOD HOLLOW o o ,^ \ ; PHASE II OVERFLOW EASEMENT y• C7 n TRACT NO. C-206 y J 4,, 1 \\ I INST. NO. D200176846 VOLUME 2793, PAGE 55 w Q y` 1 O.P.R.T.C.T. I O.P.R.T.C.T. 1C SVRv v 5 Q' i iI \\\ I' REEB SRAC R Np• 120 A S I\ I At TRINITY RIVER AUTHORITY OF TEXAS REVISED JUNE 22, 2023 5300 SOUTH COLLINS • P. 0. BOX 60 • ARLINGTON, TEXAS 76004 REVISED JULY 20, 2023 DENTON CREEK REGIONAL WASTEWATER SYSTEM DENTON CREEK PRESSURE SYSTEM OF j. FORCE MAIN AND LIFT STATION IMPROVEMENTS 1Q:G.SrfR'->` \ TEMPORARY CONSTRUCTION EASEMENT — PART TWO i.'F, \ u OWNER: CITY OF SOUTHLAKE 4 RICHARD KENNEDY SURVEY: REESE D. PRICE SURVEY, ABSTRACT NO. 1207 11' '..-P5527 Pa .(--(/• (' SUBDIVISION: LOT 30, BLOCK 1, KIRKWOOD HOLLOW PHASE II of 0 .0 LOCATION: CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS ACQUISITION AREA: 945 SQ.FT. OR 0.022 ACRES j - .I, WHOLE PROPERTY ACREAGE: 223,512 SQ.FT. OR 5.131 ACRES BY PLAT RICHARD KENNEDY G&AI JOB NO. GARV1901.00 DRAWN BY: RK CAD FILE: TCE-01E_R02.DWG REGISTERED PROFESSIONAL LAND SURVEYOR DATE: JUNE 21, 2023 EXHIBIT B PAGE 5 OF 6 SCALE: 1' = 100' NO. 5527 TEXAS FIRM No. 10106900 GORRONDONA & ASSOCIATES, INC. • 2800 N.E. LOOP 820, SUITE 660 FORT WORTH, TX. 76137 • 817-496-1424 FAX 817-496-1768 PLAT OF EXHIBIT ''B '' LED 0.30 ACRES LEGEND TRIINITY RIVEROAUTHORITY FND 5/81R OF TEXAS SET 5/8" IRON ROD WITH CAP STAMPED W/GP ILLEGIBLE" INST. O.P.R.T.0 T58243 GORRONDONA AND ASSOCIATES, INC."r'-' "' EXHIBIT •B• I FND MONUMENTATION (SIZE AND TYPE NOTED) PART ONE Ts- 6 O CALCULATED POINT II I CI ;O- P.O.B. EXHIBIT •A• I O m PROPERTY/RIGHT-OF-WAY LINE GRID COORDINATE L-6 I ii`"q EXISTING EASEMENT LINE N=7,043,078.14 m E=2,380,184.471Ti • a SURVEY/ABSTRACT LINE I z] mm u h. L-8 I INST. NO. INSTRUMENT NO. g O.P.R.T.C.T. OFFICIAL PUBLIC RECORDS OF TARRANT COUNTY, TEXAS DETAIL "B" P.R.T.C.T. PLAT RECORDS OF TARRANT COUNTY, TEXAS NOT TO SCALE P.O.B POINT OF BEGINNING LINE TABLE LINE BEARING DISTANCE L-1 N 89'23'47"E 42.19' CALLED 0.300 ACRES L-2 S 00'33'13"E 17.28'TRINITY RIVER AUTHORITY FND 5/8•IR OF TEXAS L-3 N 90'00'00"W 44.00' W/CAP INST. NO. D212158243 ILLEGIBLE"O.P.R•T•C•T L-4 N 05'35'05"E 16.91' P.O.B. L-1 L-5 N 05'35'05"E 37.01' I1 I o L-6 N 90'00'00"E 46.15' GRID COORDINATE 1 L-3 NI m L-7 S 00'33'13"E 20.00'N=7,043,114.97 E=2,380,188.08 1 v4c L-8 N 90'00'00"W 48.30' EXHIBIT •A• Am7 L-9 N 05'35'05"E 20.10' 1 P. 12 io EXHIBIT •B• I mm ORAR LOT 4R 1 LOT 30PART TWO I °~ CO STRUCTION EASEMENT -.",11- DETAIL "A" NOT TO SCALE LOT 30 NOTES: 1. A LEGAL DESCRIPTION OF SAME DATE HEREWITH ACCOMPANIES THIS PLAT. 2. ALL BEARINGS AND COORDINATES ARE REFERENCED TO THE TEXAS STATE PLANE COORDINATE SYSTEM, NAD-83,(2011), NORTH WHOLE PROPERTY MAP ANDCENTRALZONE (4202). ALL DISTANCES AND AREAS SHOWN ARE SURFACE UTILIZING A SURFACE ADJUSTMENT FACTOR OF 1.00012. LOCATION OF EASEMENT tia TRINITY RIVER AUTHORITY OF TEXAS REVISED JUNE 22, 2023 5300 SOUTH COLLINS • P. 0. BOX 60 • ARLINGTON, TEXAS 76004 REVISED JULY 20, 2023 DENTON CREEK REGIONAL WASTEWATER SYSTEM DENTON CREEK PRESSURE SYSTEM OFNMIFORCEMAINANDLIFTSTATIONIMPROVEMENTS E "" TF ,STei •.-f TEMPORARY CONSTRUCTION EASEMENT i/ C).. - Fc 4 9' I OWNER: CITY OF SOUTHLAKE 4 RICHARD KENNEDY ;) SURVEY: REESE D. PRICE SURVEY, ABSTRACT NO. 1207 r`..,0 5527 Pam:f(SUBDIVISION: LOT 30, BLOCK 1, KIRKWOOD HOLLOW PHASE II 4'2fSS\O 1,a, LOCATION: CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS T7 .'O.............'C , \ ACQUISITION AREA: 1 680 SQ.FT. OR 0.039 ACRES TOTAL R WHOLE PROPERTY ACREAGE: 223,512 SQ.FT. OR 5.131 ACRES BY PLAT' RICHARD KENNEDY GdcAI JOB NO. GARV1901.00 DRAWN BY: RK CAD FILE: TCE_01E_R02.DWG REGISTERED PROFESSIONAL LAND SURVEYOR DATE: JUNE 21, 2023 EXHIBIT B PAGE 6 OF 6 SCALE: 1' = 100' NO. 5527 TEXAS ARM No. 10106900 GORRONDONA do ASSOCIATES, INC. • 2800 N.E. LOOP 820, SUITE 660 FORT WORTH, TX. 76137 • 817-496-1424 FAX 817-496-1768 Case No. ZA23-0008 S T A F F R E P O R T September 26, 2023 CASE NO: ZA23-0008 PROJECT: Zoning Change and Site Plan for Southlake Marketplace EXECUTIVE SUMMARY: Kirkman Engineering, on behalf of SL Marketplace Partners LP is requesting approval of a Zoning Change and Site Plan for Southlake Marketplace located on a property described as Lots 5, 6, and 7, Block 1 of the Southlake Crossing Phase 2, City of Southlake, Tarrant County, Texas and located at 2001 – 2225 W Southlake Blvd., Southlake, Texas. Current Zoning: “C-3” General Commercial Zoning. Proposed Zoning: “S-P-1” Detailed Site Plan Zoning. SPIN Neighborhood #10. DETAILS: The property is located on the south side of W. Southlake Boulevard approximately 615 feet southeast of the intersection of W. Southlake Boulevard and Davis Boulevard. The purpose of this zoning change is to adopt a “S-P-1” Detailed Site Plan District with “C-3” General Commercial Zoning District uses. There are many proposed modifications throughout the parking field including lighting improvements, landscape improvements and construction of a new restaurant. With these adjustments, the impervious coverage is to remain the same while increasing the number of parking spaces. The applicant is also proposing “Birdcall”, an approximately 2,600 SF drive-thru restaurant adjacent to W. Southlake Boulevard. The building will substantially conform to the elevations and rendering provided. “S-P-1” REGULATIONS REQUESTED: Impervious coverage should not exceed 75% in “C-3” zoning. Even with added parking and a new building, the applicant is retaining the existing impervious coverage of 77.92% by redesigning parking islands and realigning parking spaces throughout the site. The applicant is proposing 578 parking spaces. 561 spaces are provided currently. The Site Plan shows 710 spaces required based on gross floor area of 25,000 square feet for restaurant uses and 92,000 square feet for retail uses. Parking is calculated based on net usable floor area, which would equate to approximately 634. The proposed 578 parking spaces is an approximately 9% variance to the required spaces. The development regulations provide for this request. Case No. ZA23-0008 The Corridor Overlay District requires “architecturally significant” columns. The regulations provide for the columns shown in the plans and rendering. Also noted is the flat roof. Roofs on buildings less than 6,000 square feet are required to be hipped. The applicant requests approval of the building as presented. The Landscape Plan shows minor variations, including three landscape islands slightly smaller than required. Two are located at the ends of the parking row immediately south of the “Birdcall”, and the third is located at the far northern portion of the site. Also proposed is artificial grass in two areas where elevated foot traffic is expected. ACTION NEEDED: 1) Consider 1st Reading Approval ATTACHMENTS: (A) Background Information (B) Vicinity Map (C) Plan Review Summary No. 4, dated September 15, 2023 (D) Surrounding Property Owners Map and Responses (E) Ordinance No. 480-804 Full Size Plans (for Commission and Council members only) PowerPoint Presentation Narrative TIA Plans STAFF CONTACT: Reagan Rothenberger (817) 748-8602 Dennis Killough (817) 748-8072 Case No. Attachment A ZA23-0008 Page 1 BACKGROUND INFORMATION OWNER/APPLICANT: SL Marketplace Partners LP PROPERTY SITUATION: 2001 – 2125 W Southlake Blvd, Southlake, TX 76092 LEGAL DESCRIPTION: 5, 6, and 7, Block 1 of the Southlake Crossing Phase 2 LAND USE CATEGORY: Retail Commercial CURRENT ZONING: “C-3” General Commercial PROPOSED ZONING: “S-P-1” Detailed Site Plan District HISTORY: The subject property was annexed into the City of Southlake in 1957 per Ordinance 78. Zoning change from “AG” to “L-2” was approved in 1988. “C-3” General Commercial District zoning was approved with the adoption of the Zoning Ordinance No 480 and the official Zoning Map on September 19, 1989. On July 6, 1995, the Planning and Zoning Commission approved the Final Plat for Lots 5, 6, 7, and 8, Block 1 of the Southlake Crossing Phase II. In January 2000, the Site Plan for Southlake Marketplace was approved by City Council. SOUTHLAKE COMPREHENSIVE PLAN: Consolidated Future Land Use Plan The future land use designation for the site is Retail Commercial. Purpose and Definition: The Retail Commercial category is a lower‐ to medium‐intensity commercial category providing neighborhood‐type retail shopping facilities and general commercial support activities. It is intended to provide limited local retail and/or office uses which serve neighborhoods in close proximity. It is intended that all uses in this category will be compatible with adjacent single family uses, thereby maintaining the character and integrity of existing neighborhoods. This category is intended to encourage comprehensively planned developments. In areas where the Retail Commercial designation is adjacent to residentially zoned properties or areas with a residential designation on the Land Use Plan, lower intensity activities such as office or office‐related uses should be planned adjacent to the residential uses. Other suitable activities are those permitted in the Public Parks/Open Space, Public/Semi‐Public, and Office Commercial categories previously discussed. Pathways Master Plan & Sidewalk Plan Per the Southlake Mobility Plan under the Pathways Plan, a greater than 8’ trail is required along the boundary of this property. This path currently Case No. Attachment A ZA23-0008 Page 2 exists. TRANSPORTATION ASSESSMENT: Area Road Network and Conditions The lots have direct access to Southlake Boulevard, a 130’ divided 6-lane Arterial Street. Traffic Impact A Traffic Impact Analysis (TIA) conducted by Lee Engineering was reviewed by Teague Nall and Perkins, Inc. (TNP) who have no reservations with the City’s acceptance of this study. The study focused on the impact of the proposed Birdcall Restaurant. The study estimates an additional 62 mid-day peak hour one-way trips and 36 evening peak hour one-way trips. It is estimated the entire Southlake Marketplace development sees approximately 7,200 trips per day in total. TREE PRESERVATION: There is 41% of existing tree cover on the site, and a minimum of 50% of the existing tree cover is required to be preserved. A maximum of 13.6% is proposed to be removed, and a minimum of 86.40% is proposed to be preserved. UTILITIES: The site is served by an 6-inch Sanitary Sewer Line and an 12-inch Water Main. CITIZEN INPUT: This project was heard at the February 7, 2022 Corridor Planning Committee Meeting and the January 10, 2023 SPIN Meeting. PLANNING AND ZONING COMMISSION ACTION: September 21, 2023; APPROVED (7-0) subject to Staff Report dated September 15, 2023 and Plan Review Summary No. 4, dated September 15, 2023, and noting approval of all variances presented. STAFF COMMENTS: Attached is the Site Plan Review Summary No. 4, dated September 15, 2023. Case No. Attachment B ZA23-0008 Page 1 Case No. Attachment D ZA23-0008 Page 2 SITE PLAN REVIEW SUMMARY Case No.: ZA23-0008 Review No.: Four Date of Review: 09/15/2023 Project Name: Site Plan & Zoning Change – Southlake Marketplace APPLICANT: OWNER: Kirkman Engineering - Sydney Foster Sl Marketplace Partners LP – Buck Wheeler 5200 State Highway 121 4809 Cole Ave., STE 330 Southlake, TX 75062 Dallas, TX Phone: 817-488-4969 Phone: 214-960-2818 Email: Sydney.foster@truske.com Email: buck@shopcompanies.com CITY STAFF HAS REVIEWED THE ABOVE REFERENCED PROJECT RECEIVED BY THE CITY ON 9/13/23 AND WE OFFER THE FOLLOWING STIPULATIONS. THESE STIPULATIONS ARE HEREBY MADE CONDITIONS OF SITE PLAN APPROVAL UNLESS SPECIFICALLY AMENDED BY THE CITY COUNCIL. IF YOU HAVE ANY QUESTIONS OR NEED FURTHER CLARIFICATION, PLEASE CONTACT REAGAN ROTHENBERGER AT (817) 748-8602. 1. Parking is being calculated by the gross floor area of the buildings which causes a higher number of parking spaces than what would normally be required. Recalculate based on net floor area. Staff estimates a parking need of approximately 640 parking spaces instead of 710. Please provide an accurate calculation of net floor area to determine actual need. Ensure all documents reflect this revision. Recalculations Noted • It is noted that S-P-1 regulations permit an Impervious Coverage of 77.92% and 578 parking spaces, both variations from the Zoning Ordinance but are existing conditions of the site. A variance to the Landscape Ordinance is noted. A regulation permitting the proposed columns on the Birdcall Building is noted. Elevations are simpler in nature. The building shall generally conform the elevations and renderings provided. Case No. Attachment D ZA23-0008 Page 3 Tree Conservation/Landscape Review 1. Although the existing trees proposed to be removed are required landscaping planted to comply with the Landscape Ordinance requirements, the proposed tree preservation complies with the existing tree cover preservation requirements of the Tree Preservation Ordinance. There is 41% of existing tree cover on the site, and a minimum of 50% of the existing tree cover is required to be preserved. A maximum of 13.6% is proposed to be removed, and a minimum of 86.40% is proposed to be preserved. * Except as provided by subsection 7.2.b. of the Tree Preservation Ordinance, a Tree Conservation Analysis or Tree Conservation Plan shall be approved if it will preserve existing tree cover in accordance with the percentage requirements established by Table 2.0. If the property has previously received a tree permit related to development, the percentage of existing tree cover at the time the first such permit was issued shall be used to calculate the minimum existing tree cover that must be preserved under this section. Table 2.0 – Existing Tree Cover Preservation Requirements Percentage of existing tree cover on the entire site Minimum percentage of the existing tree cover to be preserved* 0% – 20% 70% 20.1 – 40% 60% 40.1% - 60% 50% 60.1% - 80% 40% 80.1% - 100% 30% *The minimum percentage of existing tree cover to be preserved shall exclude any area in public rights-of-way as approved by City Council. For property sought to be zoned for the Downtown zoning district or a planned development zoning district, including an S-P-1 Site Plan, S-P-2 Site Plan, Transition, Rural Conservation, Planned Unit Development, or Employment Center zoning district, the City Council shall consider the application for a Conservation Analysis or Plan in conjunction with the corresponding development application (as established in Table 1.0). The Planning and Zoning Commission shall review the application and make a recommendation to the City Council regarding the application. The City Council shall approve the Plan or Analysis if the Council finds that the Plan or Analysis provides for the: i. placement of building pads, parking areas, driveways, streets, and utility easements so as to maximize the preservation of environmental features of the property including mature tree stands, natural creeks and ponds, and significant grades; ii. maximizes the preservation of tree cover preservation areas indicated on the Environmental Resource Protection Map; iii. maximizes the preservation of existing tree stands with the potential to buffer residential areas from the noise, glare, and visual effects of nonresidential uses; iv. maximizes the preservation of existing trees, if any, adjoining a natural or man-made drainage creek; Case No. Attachment D ZA23-0008 Page 4 v. maximizes the preservation of existing protected trees along rural roadways and other streets as identified and prioritized in the Street Typology designation; and vi. mitigation of altered trees through proposed tree replacement procedures pursuant to this Ordinance. LANDSCAPE COMMENTS: 1. The two proposed parking landscape islands on the west side of the proposed new building, and the reconfigured island in the northwest corner of Lot 7, Block 1 are narrower than the minimum required width. All new parking lot islands shall have a minimum width of 12’ back-to-back if curbed or 13’ edge-to-edge if no curb is intended and shall be equal to the length of the parking stall. SP1 Regulations Noted 2. The reconfigured parking landscape islands are proposed to contain turf grass. All parking planter islands in parking areas shall contain a minimum of one (1) canopy tree with the remaining area in shrubs, ground cover, ornamental grasses, or seasonal color. Planter islands which have light poles for lighting the parking areas may substitute two (2) understory/accent trees for the required canopy tree. SP1 Regulations Noted * The square footage of the proposed building is less than 30% of the square footage of the existing building, and less than 5,000 square feet. New construction intended to increase the square footage by less than 30% of the existing building or less than 5,000 square feet shall be required to meet the requirements herein only as it pertains to the square footage of the new construction. * Indicates informational comment. # Indicates required items comment. E-mail: kmartin@ci.southlake.tx.us Keith Martin Landscape Administrator Phone: (817) 748-8229 Case No. Attachment D ZA23-0008 Page 5 Public Works/Engineering Review GENERAL COMMENTS: No Comments Sandra Endy, P.E. Development Engineer Phone: (817) 748-8033 E-mail: sendy@ci.southlake.tx.us Case No. Attachment D ZA23-0008 Page 6 Fire Department Review 1. If the occupancy is classified as an “A-2” restaurant, an automatic fire suppression system will be required if the fire area exceeds 5,000 square feet or a total occupant load of 100 or more persons. Also, an automatic fire alarm system will then be required to monitor the fire suppression system. Kelly Clements Deputy Fire Chief/Fire Marshal Phone: (817) 748-8233 E-mail: kclements@ci.southlake.tx.us Case No. Attachment D ZA23-0008 Page 7 General Informational Comments * The Development Review Committee (DRC) has determined that this pre-submittal is sufficient for formal consideration by the Planning and Zoning Commission (P&Z). A formal submittal must be received at the City by 5:00 P.M. on by the submittal deadline shown on the City’s approved submittal and meeting schedule. A pdf of each plan must be submitted. * All mechanical equipment must be screened of view from right-of-ways and residential properties in accordance with the Zoning Ordinance No. 480, as amended. * All lighting must comply with the Lighting Ordinance No. 693, as amended. * All development must comply with the Drainage Ordinance No. 605 and the Erosion and Sediment Control Ordinance No. 946, as amended. * Development must comply with all requirements in Zoning Ordinance No. 480, Section 43, Overlay Zones. * In addition to the City of Southlake impact fees, please be aware that through the wholesale water customer contract with the City of Fort Worth, all new water connections are required to pay the City of Fort Worth impact fee. The City of Fort Worth impact fee assessment is based on the final plat recordation date and building permit issuance. The applicant is encouraged to review the City of Fort Worth's assessment and collection of Impact Fees Guide to determine the fee amount. * Denotes Informational Comment Case No. Attachment D ZA23-0008 Page 8 General Informational Comments * The Development Review Committee (DRC) has determined that this pre-submittal is sufficient for formal consideration by the Planning and Zoning Commission (P&Z). A formal submittal must be received at the City by 5:00 P.M. on by the submittal deadline shown on the City’s approved submittal and meeting schedule. A pdf of each plan must be submitted. * All mechanical equipment must be screened of view from right-of-ways and residential properties in accordance with the Zoning Ordinance No. 480, as amended. * All lighting must comply with the Lighting Ordinance No. 693, as amended. * All development must comply with the Drainage Ordinance No. 605 and the Erosion and Sediment Control Ordinance No. 946, as amended. * Development must comply with all requirements in Zoning Ordinance No. 480, Section 43, Overlay Zones. * In addition to the City of Southlake impact fees, please be aware that through the wholesale water customer contract with the City of Fort Worth, all new water connections are required to pay the City of Fort Worth impact fee. The City of Fort Worth impact fee assessment is based on the final plat recordation date and building permit issuance. The applicant is encouraged to review the City of Fort Worth's assessment and collection of Impact Fees Guide to determine the fee amount. * Denotes Informational Comment Case No. Attachment D ZA23-0008 Page 9 SURROUNDING PROPERTY OWNERS MAP SPO # Owner Zoning Physical Address Acreage Response 1 SAN DIEGO RENTALS LLC C3 1959 W SOUTHLAKE BLVD 1.06 NR 2 KICKAPOO INVESTMENTS LTD C2 2000 W SOUTHLAKE BLVD 0.46 NR 3 SL MARKETPLACE PARTNERS LP C3 2025 W SOUTHLAKE BLVD 1.02 NR 4 PROSPEROUS FUTURE, LLC C3 1957 W SOUTHLAKE BLVD 0.00 NR 5 HCCP PROPERTY PARTNERS LLC C3 170 PLAYERS CIR 0.15 NR 6 SOUTHLAKE, CITY OF SP1 2100 W SOUTHLAKE BLVD 0.62 NR 7 BARGER EQUITY GROUP LLC C3 220 PLAYERS CIR 0.80 NR 8 COMPASS BANCSHARES INC C2 2200 W SOUTHLAKE BLVD 0.15 NR 9 250 PLAYER CIRCLE LLC C3 250 PLAYERS CIR 2.06 NR 10 SLM DUNHILL LLC C3 2155 W SOUTHLAKE BLVD 1.08 NR 11 STORE MASTER FUNDING XIV LLC SP1 2201 W SOUTHLAKE BLVD 3.37 NR 12 HILL, CURTIS B SF20A 515 INDIAN PAINTBRUSH WAY 0.39 NR Case No. Attachment D ZA23-0008 Page 10 13 HAFEEZ, ABDUL SF20A 519 INDIAN PAINTBRUSH WAY 0.54 NR 14 HAIDER, MAUNAWAR SF20A 523 INDIAN PAINTBRUSH WAY 0.55 NR 15 BROWN, MICHAEL SF20A 1900 SHOOTING STAR LN 0.46 NR 16 THILL, THOMAS C SF20A 1904 SHOOTING STAR LN 0.45 NR 17 SPRINGS, WILLIAM A SF20A 1908 SHOOTING STAR LN 0.44 NR 18 CHANG, CHENG SF20A 527 INDIAN PAINTBRUSH WAY 0.52 NR 19 FRASER, TONYA SF20A 1912 SHOOTING STAR LN 0.17 NR 20 SHARMA, VIPIN SF20A 1903 SHOOTING STAR LN 0.04 NR 21 SOLEDAD, KING SF20A 1905 SHOOTING STAR LN 0.03 NR 22 IQBAL, AHMED SF20A 1909 SHOOTING STAR LN 0.46 NR 23 CRAFTON, ADAM L SF20A 601 INDIAN PAINTBRUSH WAY 0.45 NR 24 FRITZ, MARK RICHARD SF20A 600 INDIAN PAINTBRUSH WAY 0.54 NR 25 PARR, JOSEPH SF20A 520 INDIAN PAINTBRUSH WAY 0.51 NR 26 IVEY, BRIAN SF20A 524 INDIAN PAINTBRUSH WAY 0.50 NR 27 SURAVARAM, SMITHA SF20A 516 INDIAN PAINTBRUSH WAY 0.74 NR 28 MYERS MEADOW HOMEOWNERS ASSN RPUD 100 MEADOWLARK LN 10.78 NR 29 HOLIDAN INVESTMENTS INC C2 2210 W SOUTHLAKE BLVD 1.04 NR 30 SHAW, JACK A SF20A 511 INDIAN PAINTBRUSH WAY 0.56 NR 31 BLUE PEACHES LLC C3 251 PLAYERS CIR 0.98 NR 32 POREDDY, KALPANA SF20A 1916 SHOOTING STAR LN 0.61 NR 33 SLM DUNHILL LLC C3 2225 W SOUTHLAKE BLVD 2.63 NR 34 OKAFO, NNEKA TZD 300 WINDING RIDGE TRL 0.30 NR 35 MYERS MEADOW HOMEOWNERS ASSN RPUD 1970 W SOUTHLAKE BLVD 4.22 NR 1000 SLM DUNHILL LLC C3 2001 W SOUTHLAKE BLVD 2.40 U 1001 SLM DUNHILL LLC C3 2055 W SOUTHLAKE BLVD 0.82 U 1002 SLM DUNHILL LLC C3 2101 W SOUTHLAKE BLVD 9.11 U Responses: F: In Favor O: Opposed U: Undecided NR: No Response Notices Sent: Thirty-eight (38) Responses Received within 300’: In Favor: Opposed: Undecided: No Response: Case No. Attachment E ZA23-0008 Page 1 SURROUNDING PROPERTY OWNERS’ RESPONSES None Received by 9/15/2023 Case No. Attachment F ZA23-0008 Page 1 CITY OF SOUTHLAKE, TEXAS ORDINANCE NO. 480-804 AN ORDINANCE AMENDING ORDINANCE NO. 480, AS AMENDED, THE COMPREHENSIVE ZONING ORDINANCE OF THE CITY OF SOUTHLAKE, TEXAS; GRANTING A ZONING CHANGE ON LOTS 5, 6, AND 7, BLOCK 1 OF THE SOUTHLAKE CROSSING PHASE 2, CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS AND MORE FULLY AND COMPLETELY DESCRIBED IN EXHIBIT “A” FROM “C-3” GENERAL COMMERCIAL DISTRICT TO “S-P-1” DETAILED SITE PLAN DISTRICT , AS DEPICTED ON THE APPROVED SITE PLAN ATTACHED HERETO AND INCORPORATED HEREIN AS EXHIBIT “B”, SUBJECT TO THE SPECIFIC REQUIREMENTS CONTAINED IN THIS ORDINANCE; CORRECTING THE OFFICIAL ZONING MAP; PRESERVING ALL OTHER PORTIONS OF THE ZONING ORDINANCE; DETERMINING THAT THE PUBLIC INTEREST, MORALS AND GENERAL WELFARE DEMAND THE ZONING CHANGES AND AMENDMENTS HEREIN MADE; PROVIDING THAT THIS ORDINANCE SHALL BE CUMULATIVE OF ALL ORDINANCES; PROVIDING A SEVERABILITY CLAUSE; PROVIDING FOR A PENALTY FOR VIOLATIONS HEREOF; PROVIDING A SAVINGS CLAUSE; PROVIDING FOR PUBLICATION IN THE OFFICIAL NEWSPAPER; AND PROVIDING AN EFFECTIVE DATE. WHEREAS, the City of Southlake, Texas is a home rule City acting under its Charter adopted by the electorate pursuant to Article XI, Section 5 of the Texas Constitution and Chapter 9 of the Texas Local Government Code; and, WHEREAS, pursuant to Chapter 211 of the Local Government Code, the City has the authority to adopt a comprehensive zoning ordinance and map regulating the location and use of buildings, other structures and land for business, industrial, residential, and other purposes, and to amend said ordinance and map for the purpose of promoting the public health, safety, morals and general welfare, all in accordance with a comprehensive plan; and, WHEREAS, the hereinafter described property is currently zoned as “C-3” GENERAL COMMERCIAL ZONING DISTRICT under the City’s Comprehensive Zoning Ordinance; and, Case No. Attachment F ZA23-0008 Page 2 WHEREAS, a change in the zoning classification of said property was requested by a person or corporation having a proprietary interest in said property; and, WHEREAS, the City Council of the City of Southlake, Texas, at a public hearing called by the City Council did consider the following factors in making a determination as to whether these changes should be granted or denied: safety of the motoring public and the pedestrians using the facilities in the area immediately surrounding the sites; safety from fire hazards and damages; noise producing elements and glare of the vehicular and stationary lights and effect of such lights on established character of the neighborhood; location, lighting and types of signs and relation of signs to traffic control and adjacent property; street size and adequacy of width for traffic reasonably expected to be generated by the proposed use around the site and in the immediate neighborhood; adequacy of parking as determined by requirements of this ordinance for off- street parking facilities; location of ingress and egress points for parking and off-street loading spaces, and protection of public health by surfacing on all parking areas to control dust; effect on the promotion of health ad the general welfare; effect on light and air; effect on the over-crowding of the land; effect on the concentration of population, and effect on transportation, water, sewerage, schools, parks and other public facilities; and, WHEREAS, the City Council of the City of Southlake, Texas, further considered among other things the character of the districts and their peculiar suitability for particular uses and the view to conserve the value of the buildings, and encourage the most appropriate use of the land throughout this City; and, WHEREAS, the City Council of the City of Southlake, Texas, does find that there is a public necessity for the zoning changes, that the public demands them, that the public interest clearly requires the amendments, and that the zoning changes do not unreasonably invade the rights of those who bought or improved property with reference to the classification which existed Case No. Attachment F ZA23-0008 Page 3 at the time their original investment was made; and, WHEREAS, the City Council of the City of Southlake, Texas, does find that the changes in zoning lessen the congestion in the streets, helps secure safety from fire, panic, and other dangers, promotes the health and the general welfare, provides adequate light and air, prevents the over-crowding of land, avoids undue concentration of population, and facilitates the adequate provision of transportation, water, sewerage, schools, parks and other public requirements; and, WHEREAS, the City Council of the City of Southlake, Texas, has determined that there is a necessity and need for the changes in zoning and has also found and determined that there has been a change in the conditions of the property surrounding and in close proximity to the tract or tracts of land requested for a change since the tract or tracts of land were originally classified and therefore feels that the respective changes in zoning classification for the tract or tracts of land are needed, are called for, and are in the best interest of the public at large, the citizens of the city of Southlake, Texas, and helps promote the general health, safety and welfare of the community. NOW, THEREFORE, BE IT ORDAINED BY THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS: SECTION 1. That Ordinance No. 480, the Comprehensive Zoning Ordinance of the City of Southlake, Texas, passed on the 19th day of September, 1989, as originally adopted and amended, is hereby amended so that the permitted uses in the hereinafter described areas be altered, changed and amended as shown and described below: Being described as … as depicted on the approved Site Plan attached hereto and incorporated herein as Exhibit “B”, and subject to the following conditions: 1. List any conditions Case No. Attachment F ZA23-0008 Page 4 SECTION 2. That the City Manager is hereby directed to correct the Official Zoning map of the City of Southlake, Texas, to reflect the herein changes in zoning. SECTION 3. That in all other respects the use of the tract or tracts of land herein above described shall be subject to all the applicable regulations contained in said Zoning Ordinance and all other applicable and pertinent ordinances for the City of Southlake, Texas. All existing sections, subsections, paragraphs, sentences, words, phrases and definitions of said Zoning Ordinance are not amended hereby, but remain intact and are hereby ratified, verified, and affirmed. SECTION 4. That the zoning regulations and districts as herein established have been made in accordance with the comprehensive plan for the purpose of promoting the health, safety, morals and the general welfare of the community. They have been designed, with respect to both present conditions and the conditions reasonably anticipated to exist in the foreseeable future; to lessen congestion in the streets; to provide adequate light and air; to prevent over-crowding of land; to avoid undue concentration of population; and to facilitate the adequate provision of transportation, water, sewerage, drainage and surface water, parks and other commercial needs and development of the community. They have been made after a full and complete hearing with reasonable consideration among other things of the character of the district and its peculiar suitability for the particular uses and with a view of conserving the value of buildings and encouraging the most appropriate use of land throughout the community. SECTION 5. That this ordinance shall be cumulative of all other ordinances of the City of Southlake, Texas, affecting zoning and shall not repeal any of the provisions of said ordinances except in Case No. Attachment F ZA23-0008 Page 5 those instances where provisions of those ordinances are in direct conflict with the provisions of this ordinance. SECTION 6. That the terms and provisions of this ordinance shall be deemed to be severable and that if the validity of the zoning affecting any portion of the tract or tracts of land described herein shall be declared to be invalid, the same shall not affect the validity of the zoning of the balance of said tract or tracts of land described herein. SECTION 7. Any person, firm or corporation who violates, disobeys, omits, neglects or refuses to comply with or who resists the enforcement of any of the provisions of this ordinance shall be fined not more than Two Thousand Dollars ($2,000.00) for each offense. Each day that a violation is permitted to exist shall constitute a separate offense. SECTION 8. All rights and remedies of the City of Southlake are expressly saved as to any and all violations of the provisions of Ordinance No. 480, as amended, or any other ordinances affecting zoning which have accrued at the time of the effective date of this ordinance; and, as to such accrued violations and all pending litigation, both civil and criminal, whether pending in court or not, under such ordinances, same shall not be affected by this ordinance but may be prosecuted until final disposition by the courts. SECTION 9. The City Secretary of the City of Southlake is hereby directed to publish the proposed ordinance in its entirety on the City website together with a notice setting out the time and place for a public hearing thereon at least ten (10) days before the second reading of this ordinance, and it this ordinance provides for the imposition of any penalty, fine or forfeiture for any violation Case No. Attachment F ZA23-0008 Page 6 of any of its provisions, then the City Secretary shall additionally publish this ordinance in the official City newspaper one time within ten (10) days after passage of this ordinance, as required by Section 3.13 of the Charter of the City of Southlake. SECTION 10. This ordinance shall be in full force and effect from and after its passage and publication as required by law, and it is so ordained. PASSED AND APPROVED on the 1st reading the _____ day of _____, 2023. _________________________________ MAYOR ATTEST: _________________________________ CITY SECRETARY PASSED AND APPROVED on the 2nd reading the _____ day of _______, 2023. ________________________________ MAYOR ATTEST: ________________________________ CITY SECRETARY APPROVED AS TO FORM AND LEGALITY: _________________________________ Case No. Attachment F ZA23-0008 Page 7 CITY ATTORNEY DATE:___________________________ ADOPTED:_______________________ EFFECTIVE:______________________ Case No. Attachment F ZA23-0008 Page 8 EXHIBIT “A” Lots 5, 6, and 7, Block 1 of the Southlake Crossing Phase 2, City of Southlake, Tarrant County, Texas Case No. Attachment F ZA23-0008 Page 9 EXHIBIT “B” Reserved for previously approved Site Plan Southlake Marketplace Item 7A ZA23-0008 ZA23-0008 OWNER: SL Marketplace Partners LP APPLICANT: Kirkman Engineering REQUEST: Zoning Change and Site Plan for Southlake Marketplace, for property described as Lots 5, 6, and 7, Block 1, Southlake Crossing Phase II, an addition to the City of Southlake, Tarrant County, Texas and located at 2001- 2115 W. Southlake Blvd., Southlake, Texas. Current Zoning: “C-3” General Commercial District. Requested Zoning: “S-P-1” Detailed Site Plan District. LOCATION: 2001-2125 W. Southlake Blvd Aerial Map Zoning Future Land Use Site Plan Birdcall Site Elevations Rendering Changes to Open Space Parking Calculations - Variance Approx 9% Proposed Landscape Plan Surrounding Property Owner Responses For: Opposed: Undecided: Within 300’ PLANNING AND ZONING COMMISSION ACTION: September 21, 2023; APPROVED (7-0), subject to Staff Report dated September 15, 2023, and Plan Review Summary No. 4 dated September 15, 2023, and noting approval of variances as requested. Questions? Southlake Marketplace City of Southlake Planning & Zoning Meeting September 21, 2023 TABLE OF CONTENTS • Existing Proper ty Conditions • Proposed Improvements o Common Area Improvements o New Greenspace & Patio Areas o New Restaurant Building o Façade Improvements • Social, Environmental & Economic Metrics • Leasing Update SHOP Development works on projects that make an impact beyond real estate. At SHOP, we measure our success in terms of improvements to the Social, Environmental and Economic health of the communities that we work with. EXISTING PROPERTY EXISTING CONDITIONS • Inefficient Entry Points to Shopping Center • Poor Wayfinding & Signage • Lack of Trees at Parking Lot • Lack of Outdoor Social Spaces • Dated Storefront Facade • Poor Street Presence • Minimal Landscape • Not Pedestrian Friendly COMMON AREA IMPROVEMENTS COMMON AREA IMPROVEMENTS BEFORE PROPOSED NEW GREENSPACE & PATIO AREAS NEW GREENSPACE & PATIO AREAS Patio with Cafe Seating and Railing Overhead Decorative Pergola Planted Area Pedestrian Walkway Open Lawn with String Lights Decorative Screen Wall 1 1 1 2 2 3 3 4 5 66 4 5 LEGEND 0 10’ 20’40’ SCALE: 1”= 20’ N NEW GREENSPACE & PATIO AREAS BEFORE PROPOSED NEW RESTAURANT BUILDING NEW RESTAURANT BUILDING BEFORE PROPOSED SOUTHLAKE BLVD SOUTHLAKE BLVD • Addition of 3,500 SF of outdoor patio seating • Improvement to pedestrian scale experience • Heat island reduction by removing existing parking lot and replacing with open space and additional canopy trees • Addition of 33 canopy trees, increasing carbon sequestration by 23,727 pounds a year and reducing stormwater runof f by 37,257 gallons a year in 20 years • Addition of 8,270 SF of planted area • New full and part-time job creation • Increased Net Operating Income drives significant incremental ad valorem and sales tax revenue • Improves values of surrounding residential and commercial properties • Attracts (net) new tenants to Southlake • Reinvestment supports existing area business METRICS OF PROPOSED IMPROVEMENTS LEASING UPDATE Southlake Marketplace City of Southlake September 21, 2023 THANK YOU SHOP Companies 4809 Cole Ave. Suite 330 Dallas, Tx 75205 214.960.2818 July 31st, 2023 Department of Planning & Development Services City of Southlake 1400 Main Street, Suite 310 Southlake, Texas 76092 Letter of Intent – Southlake Marketplace Zoning Change & Site Plan Dear Mr. Killough, Southlake Marketplace (the “Property”) is an existing neighborhood retail shopping center located on the southeast quadrant of W. Southlake Boulevard and Davis Boulevard. The Property was originally developed in 1996 and 2000, and currently includes Hobby Lobby, Delucca Pizza, Baskin Robbins, and others in the tenant-mix. The Property is currently zoned C-3. The Property is in good condition, but it has historically lacked reinvestment to better cater to the surrounding communities’ needs and better compliment its neighbors being the Stampede Sports Arena and Carroll Senior High School. SL Marketplace Partners LP (the “Owner”) purchased the Property in April 2022 and has since re- painted the shopping center. Additional improvements Ownership is proposing in this zoning application include constructing oversized landscaped islands throughout the parking field, parking lot lighting improvements, enhanced landscape improvements, increased parking operations and efficiency, and the creation of a greenspace to provide opportunity for future restaurant patio areas to open onto. These proposed improvements will increase the total area of landscaping on the Property, increase the total number of parking stalls than what exists today, enhance the pedestrian-scale experience for customers, and further attract better restaurants and service-oriented businesses to operate at Southlake Marketplace. These proposed improvements are similar in nature to other projects that have been successfully repositioned by the new ownership group, including Hillcrest Village in North Dallas, Lakeridge Village in East Dallas, Casa View Shopping Center in East Dallas, and San Miguel Square in Midland, TX. The addition of landscaped area, improved site efficiency, the creation of oversized patio areas, and improved site lighting are impactful ingredients in enhancing the pedestrian-scale experience to further drive community traffic and high-quality tenants to each property. On behalf of SL Marketplace Partners LP, we appreciate your consideration, and we are grateful to be working in the Southlake community with the goal of re-establishing Southlake Marketplace. Sincerely, Buck Wheeler SOUTHLAKE BLVDINDIAN PAINTBRUSH WAYDAVIS BLVDWINDING RIDGE T R L PLAYERS CIRSTONEBURY DRSHOOTIN G S T A R L NRANDOL MILL AVE21 2019 17 16 15 18 8 14 4 1 5 7 12 13 9 3 10 11 6 2 1000 1001 1002 Vicinity Map ZA23-0008 ® 0 340 680170 Feet 2001- 2115 W. Southlake Blvd. Legend City Parcels Right Of Way City Limit Case Parcel(s) 200 Foot Buffer 300 Foot Buffer Parcels Within Buffer SOUTHLAKE MARKETPLACE Narrative for Zoning and SP-1 Detailed Site Plan Development/Redevelopment Plan for 11.7-Acres of Land Lot 5, 6 & 7, Block 1 (Near Southeast Corner of Southlake Boulevard and Davis Boulevard) Please accept this document as a request on behalf of the above referenced development. If accepted, this 11.7 acre development will occupy the lots mentioned above with improvements to the parking, open spaces and existing buildings. The requested zoning is S-P-1 with C-3 General Commercial District Uses as described in the Southlake Comprehensive Zoning Ordinance. The existing center will be upgraded, including building improvements, increased patio space, increased parking, improved open space and a new retail pad site. Access to the site will remain from Southlake boulevard and Davis Boulevard. The site plan increases parking by restriping existing spaces. Oversized landscape islands are proposed where striping will be redone. Previously redundant fire lane will be replaced with patios and open spaces between buildings 2001 and 2105. The lawn adjacent to Starbucks will be redesigned for a small retail pad site with food service, large patio and activated outdoor space. The existing building architecture will remain, but have already been painted to improve the look of the center. The design and layout of the shopping center is in near compliance with the ordinances of the City of Southlake. The modifications are as follows: Item 1: Open Space: Current open space is currently 2.08%. This is to remain. **Open space calculations do not include proposed patio area. Item 2: Impervious Coverage: Current total impervious coverage is currently 77.92%. This is to remain. **This deviates from the C-3 maximum impervious coverage of 75%. Item 3: Parking: The number of parking spaces provided for this project are 578, which is an increase from the previously approved 561 parking spaces. Parking space areas are to be redesigned and will include additional landscape islands. The parking spaces proposed shall accommodate a maximum of 25,000 square feet of restaurant excluding patio space. **Per C-3 code if 25,000 square feet of the net floor area is restaurant and the remaining 92,014 square feet is retail, the required parking is 634 spaces. Item 4: Landscaping: Proposed landscape islands are shown in the Site Plan and are included in the updated open space calculations. Previously approved open space along Southlake Boulevard has been proposed as a high-end restaurant pad site with outdoor patio and open space as shown in the SP-1 submittal. Item 5: Architectural Feature: Proposed columns for new retail site differ from Town Code. **The architectural design style proposes steel cylinder columns for the canopy columns. These are not considered “architecturally significant”. However, the applicant is requesting approval as designed and submitted. The proposed columns match the proposed retail building design style and resemble the existing minor column design in the existing center. The overall development complies with the required setbacks and buffer yards from the previously approved Site Plan. We believe the project quality is consistent with the standards of the Town of Southlake and will be a significant improvement to the existing center. The proposed items in the SP-1 will attract high end tenants and improve the overall quality of the area. Rounded Up Name Notes 2001 W. Southlake Blvd.7 103 Delucca Pizza 3,736 Restaurant 100 37.36 38.00 2001 W. Southlake Blvd.7 111 Noli Oils 1,050 Retail Shop 200 5.25 6.00 2001 W. Southlake Blvd.7 115 Kurt Calendar Dental 1,390 Medical Office 150 9.27 10.00 2001 W. Southlake Blvd.7 119 Indian Restaurant 1,553 Restaurant 100 15.53 16.00 2001 W. Southlake Blvd.7 123 Taco House 1,098 Restaurant 100 10.98 11.00 2001 W. Southlake Blvd.7 127 Semper Laser Former Vacancy 1,383 Personal Service Shop 200 6.92 7.00 2001 W. Southlake Blvd.7 131 Tailor/Shoe 1,031 Personal Service Shop 200 5.16 6.00 2001 W. Southlake Blvd.7 135 Southlake Math & Reading 1,034 Personal Service Shop 200 5.17 6.00 2001 W. Southlake Blvd.7 143 Southlake Jazzercise Former Vacancy 2,323 Retail Shop 200 11.62 12.00 2001 W. Southlake Blvd.7 155 VACANT Former portion of ATA Martial Arts 1,303 Personal Service Shop 200 6.52 7.00 2001 W. Southlake Blvd.7 155 Rise Souffle Working Lease in part of former ATA Martial Arts space 3,057 Restaurant 100 30.57 31.00 2105 W. Southlake Blvd.5 201 Rye Former Golden China space 2,863 Restaurant 100 28.63 29.00 2105 W. Southlake Blvd.5 215 Rye Former Vacancy 1,313 Restaurant 100 13.13 14.00 2105 W. Southlake Blvd.5 225 Bicycles Inc 7,669 Retail Shop 200 38.35 39.00 2105 W. Southlake Blvd.5 245 Ron Groves Ortho 2,871 Medical Office 150 19.14 20.00 2115 W. Southlake Blvd.5 2115 Hobby Lobby 45,600 Retail Shop 200 228.00 228.00 Hobby Lobby Warehouse Portion 5,243 1000 5.24 6.00 Hobby Lobby Office Portion 2,356 Office (General)300 8.00 8.00 2125 W. Southlake Blvd.5 325 Mircale Ear Relocation space 1,497 Office (General)300 4.99 5.00 2125 W. Southlake Blvd.5 335 Nail Studio 1,435 Personal Service Shop 200 7.18 8.00 2125 W. Southlake Blvd.5 345 Old World Salons 6,719 Personal Service Shop 200 33.60 34.00 2125 W. Southlake Blvd.5 365 ATA Martial Arts Former Foot Spa space 1,247 Personal Service Shop 200 6.24 7.00 2125 W. Southlake Blvd.5 375 ATA Martial Arts Former Scratch Kitchen Catering space 1,319 Personal Service Shop 200 6.60 7.00 2125 W. Southlake Blvd.5 395 ATA Martial Arts Former Vacancy 1,052 Personal Service Shop 200 5.26 6.00 2055 W. Southlake Blvd.6 2055 Bread Winners Café Former Miracle Ear space 1,314 Restaurant 100 13.14 14.00 2059 W. Southlake Blvd.6 2059 Bread Winners Café Former Adrienne's Fun Fitness 2,232 Restaurant 100 22.32 23.00 2063 W. Southlake Blvd.6 2063 Baskin Robbins 1,005 Restaurant 100 10.05 11.00 NEW (TBD)TBD Birdcall Current Greenspace area for new building 2,500 Restaurant 100 25.00 25.00 107,193 5.78 619.17 634.00 Total Parks Required:634.00 Parks Provided (CAPEX):5.39 578.00 Parking Surplus / (Deficit):(56.00) Variance Needed:8.83% TOTAL: Net SF Use Category Summary SOUTHLAKE MARKETPLACE SHOPPING CENTER Davis Blvd. & W. Southlake Blvd. Tenant Parking Analysis Date: 09-18-2023 Address Suite Parking Requirement Parking RatioTenantLot ELEC S M P P P F P F WVWV SS FH WM CO CO CO COCO ELEC ELEC ELEC CO CO CO CO COCO CO CO COCO CO COCO SS SS SSCO CO ELEC ELEC FH FH FH WV WV WVWV WV FH WV WV WVWV WV WV WV ELEC LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP WV WV WV WM WMWM WM WM GM GM ELEC FH ELEC LP LP ELECELEC FH SS SS COCO CO CO CO ELEC ELEC LP TELE WM WM WM SD SD SD ELEC WM ELEC WM WM WM ELEC ELEC ELEC ELEC ELEC SDSD EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R PLAYERS CIRCLE ADDITION CABINET A, SLIDE 10975 P.R.T.C.T. 250 PLAYER CIRCLE LLC, ZONING C-3 L.U.D. = RETAIL COMMERCIAL LOT 5, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 6, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 8, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) SL MARKETPLACE PARTNERS LP, ZONING C-3 L.U.D. = RETAIL COMMERCIAL TRACT 3 LOT 2R, BLOCK 1, SOUTHLAKE CROSSING PHASE I (CABINET A, SLIDE 1613, P.R.T.C.T.) TRACT 3 LOT 2R, BLOCK 1, SOUTHLAKE CROSSING PHASE I (CABINET A, SLIDE 1613, P.R.T.C.T.) STORE MASTER FUNDING XIV LLC, ZONING SP1 L.U.D. = RETAIL COMMERCIAL LOT 7, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) 25' U TI LI T Y E A S E M E N T CABI N E T A, S LI D E 2 4 2 5 P.R. T. C. T. 50' B UI L DI N G LI N E CABI N E T A, S LI D E 2 4 2 5 P.R. T. C. T. 15' UTILITY EASEMENT CABINET A, SLIDE 1613 P.R.T.C.T. 50' B UI L DI N G LI N E CABI N E T A, S LI D E 1 6 1 4 P.R. T. C. T. 10 i. 10 i. 10 f. 10 g. 30' S E T B A C K (PER Z O NI N G) 30' S E T B A C K (PER Z O NI N G)25' SETBACK(PER ZONING)25' SETBACK(PER ZONING)10' SETBACK (PER ZONING) 10' S E T B A C K (PER Z O NI N G) 15' DRAINAGE & UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. 20' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j.15' DRAINAGE & UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. (TRACT 3) 40' PERIMETER ACCESS DRIVE EASEMENT VOLUME 9734, PAGE 478 & VOLUME 11474, PAGE 1894 VOLUME 14393, PAGE 448 48' DRAINAGE EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 i. (TRACT 3) 40' PERIMETER ACCESS DRIVE EASEMENT VOLUME 9734, PAGE 478 & VOLUME 11474, PAGE 1894 VOLUME 14393, PAGE 448 PART OF TRACT 3 40' PERIMETER, ACCESS DRIVE, VOLUME 9734, PAGE 478 & VOLUME 11474, PAGE 1694 VOLUME 14393, PAGE 448 D.R.T.C.T. 48' DRAINAGE & UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 i. 25' COMMON ACCESS EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. 15' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 i. 15' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. 15' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. 25' UTILITY EASEMENT CABINET A, SLIDE 1614 P.R.T.C.T. 10 g. 25'X52' COMMON ACCESS EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 i. 35' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. (TRACT 3) 40' PERIMETER ACCESS DRIVE EASEMENT VOLUME 9734, PAGE 478 & VOLUME 11474, PAGE 1894 VOLUME 14393, PAGE 448 N51° 2 6' 3 4" E 565. 0 0'N3 8 ° 3 3 ' 2 6 "W 2 2 0 . 0 0 ' S51° 2 6' 3 4" W 80.0 0'N3 8 ° 3 3 ' 2 6 "W 1 9 6 . 7 4 ' N51° 2 5' 3 5" E 114. 3 3'S3 8 ° 3 4 ' 1 9 "E 1 5 9 . 5 8 ' N51° 2 5' 4 1" E 226. 9 2'S3°37'47"E1044.45'N89°50'53"W 317.33' S51° 2 6' 3 4" W 65.8 5'N3 8 ° 3 3 ' 2 6 "W 1 9 0 . 0 0 ' S51° 2 6' 3 5" W 20.0 0'N3 8 ° 3 3 ' 2 6 "W 2 0 5 . 0 0 ' 50' BUILDING LINE CABINET A, SLIDE 2425 P.R.T.C.T. W. SO U T H L A K E B L V D (F.M . H W Y N O . 1 7 0 9 ) (VA R I A B L E W I D T H R O W ) LOT 4, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 1614, P.R.T.C.T.) SLM DUNHILL LLC, ZONING C-3 L.U.D. = RETAIL COMMERCIAL 25' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. PROP. OPEN SPACE PROP. PATIO PROP. PATIO EX. BUILDING #2115 ZONING C-3 71,301 SF EX. BUILDING #2105 ZONING C-3 15,561 SF EX. BUILDING #2001 ZONING C-3 20,236 SF R5' R 3'R5'EX. BUILDING ZONING C-3 5,000 SF DRIVETHRU 9 9 9 9 8 8 9 9 8 8 8 8 8 8 8 8 8 8 15 12 24 22 14 12 9 9 8 8 9 9 9 9 9 9 15 3 8 5 5 2 6 8 17 5 6 6 2 12 15 4 7 6 4 11 5 14 2 6 7 14 11 7 11 4 10 8 15.0'15.0'65.0' 24.0' 9 . 0 ' 18.0'(TYP.) 18.0' 18.0' 18.0' 18.0' 18.0' 18.0' 18.0' 18.0' 18.0' 9 . 0 ' 9 . 0 ' 18.0' 9 . 0 ' 9 . 0 ' 9 . 0 ' 9 . 0 ' 9 . 0 ' 9 . 0 ' 9 . 0 ' 9 . 0 ' 24.0' 24.0' 24.1'24.1'24.0' 24.0' 24.0' PROP. 5' SIDEWALK PROP. DUMPSTER (MIN. 8' TALL SCREEN) PROP. 7' CONCRETE SIDEWALK EX. 6 LANE ASPHALT ROAD PROP. BUILDING ZONING C-3 2,605 SF PROP. PATIO 7 0 . 0 ' 15.0' R3 'R3'R5'R3'R 5' R5' R5'R5'R5 'R5'R5'R5'R5'R5'R5'R5'R 5 'R 10'R20' R5 'R 10'R5'R3 'R3'R 5'R5' R3'R3'R 5'R5'R10'R3'R9'R 1 0 ' R 9 '31.1' 24.0' PROP. CURB INLET EX. DUMPSTER EX. DUMPSTER EX. DUMPSTER EX. DUMPSTER EX. DUMPSTER EX. DUMPSTER EX. DUMPSTER EX. STONE RETAINING WALL (VARYING HEIGHTS) EX. 2' CONCRETE WALL 40' STACKING DEPTH 55' STACKING DEPTH EX. 4 0. 6' DRI V E ( A) EX. 3 9. 3' DRI V E ( B) 498. 7' PROP. PATIO 1 1 . 0 ' 18.0' 9 . 0 ' (TYP . ) 16.0'14.0'PROP. SIGN 24.0' LEGEND 1 FILENAME: SITE PLAN_SHP22002.dwgPLOTTED BY: Sydney FosterFULL PATH: K:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site PlanK:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site Plan\SITE PLAN_SHP22002PLOTTED DATE: 9/13/2023SITE PLAN CITY PROJECT NO. ZA23-0008 SOUTHLAKE MARKETPLACE 11.646 ACRES LOT 5, 6 & 7, BLOCK 1 ALTA/ACSM LAND TITLE SURVEY (INST. NO. 20190215010000670) CITY OF SOUTHLAKE, TARRANT COUNTY, TEXAS PREPARATION DATE: 9/13/2023 OWNER/APPLICANT SHOP COMPANIES 4809 COLE AVE #330 DALLAS, TX 75205 PH: 214-960-4545 CONTACT: BUCK WHEELER LANDSCAPE ARCHITECT BUD CREATIVE 3800 MAIN ST., STE. B DALLAS, TX 75226 PH: 404-580-3234 CONTACT: ZAC MILLER, RLA ENGINEER KIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 PH: 817-488-4960 CONTACT: SHEA KIRKMAN, PE SURVEYOR TEXAS HERITAGE SURVEYING, LLC 10610 METRIC DR, SUITE 124 DALLAS, TX 75243 PH: 214-340-9700 CONTACT: GARY E. JOHNSON, RPLS PRELIMINARY SITE PLAN GRAPHIC SCALE FEET012060 SCALE: 1" = 60' FIRE LANE STRIPING ACCESSIBLE ROUTE PARKING COUNT BUILDING ENTRANCE PROPOSED SANITARY MANHOLE PROPOSED CURB INLET PROPOSED TRENCH DRAIN PROPOSED RETAINING WALL PROPERTY BOUNDARY FIRELANE 10 SITE BENCHMARKS ALL EVELATIONS ARE BASED ON CITY OF SOUTHLAKE BM NO. 33 LOCATED AT LAT. 32°56'30.52072"N, LONG. 97°11"07.20706"W ALUMINUM MONUMENT IN CONCRETE. ELEVATION = 657.38' (NAD '83) KE PROJECT CLIENT LOGO 4809 COLE AVE #330 DALLAS, TX 75205 214-960-4545 SHEET:REV:DATE:DESCRIPTION:SOUTHLAKEMARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXASKIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 TEXAS FIRM NO. 15874 JOB NUMBER: ISSUE DATE: SHP22002 9/13/2023 E N G I N E E R I N G P R E L I M I N A R Y F O R R E V I E W O N L Y T H E S E D O C U M E N T S A R E F O R D E S I G N R E V I E W O N L Y A N D N O T I N T E N D E D F O R T H E PURPOSES OF CONSTRUCTION, B I D D I N G O R P E R M I T . T H E Y W E R E P R E P A R E D B Y , O R UN DE R THE S U P ER VI S IO N OF : P.E.# 91865 SHEA O. KIRKMAN DATE: September 13, 2023 VICINITY MAP N.T.S. W SO U T H A L K E B L V D PROJECT SITE S PEYTONVILLE AVEKINGSLEY CT WINDING RIDGE TRAILJELLICO CIRJOHNSON RD RANDOL MILL AVEDAVIS BLVDW SOUTHA L K E B L V D MEADOWLARK LNSS 8 1011 EX. BUILDING ZONING C-3 71,301 SF EX. BUILDING ZONING C-3 15,561 SF EX. BUILDING ZONING C-3 20,236 SF DRIVETHRU ELEC S M P P P F P F WVWV SS FH WM CO CO CO COCO ELEC ELEC ELEC CO CO CO CO COCO CO CO COCO CO COCO SS SS SSCO CO ELEC ELEC FH FH FH WV WV WVWV WV FH WV WV WVWV WV WV WV ELEC LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP WV WV WV WM WMWM WM WM GM GM ELEC FH ELEC LP LP ELECELEC FH SS SS COCO CO CO CO ELEC ELEC LP TELE WM WM WM SD SD SD ELEC WM ELEC WM WM WM ELEC ELEC ELEC ELEC ELEC SDSD EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R PLAYERS CIRCLE ADDITION CABINET A, SLIDE 10975 P.R.T.C.T. 250 PLAYER CIRCLE LLC, ZONING C-3 L.U.D. = RETAIL COMMERCIAL LOT 5, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 6, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 8, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) SL MARKETPLACE PARTNERS LP, ZONING C-3 L.U.D. = RETAIL COMMERCIAL TRACT 3 LOT 2R, BLOCK 1, SOUTHLAKE CROSSING PHASE I (CABINET A, SLIDE 1613, P.R.T.C.T.) TRACT 3 LOT 2R, BLOCK 1, SOUTHLAKE CROSSING PHASE I (CABINET A, SLIDE 1613, P.R.T.C.T.) STORE MASTER FUNDING XIV LLC, ZONING SP1 L.U.D. = RETAIL COMMERCIAL LOT 7, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) 30' S E T B A C K (PER Z O NI N G) 30' S E T B A C K (PER Z O NI N G) N51° 26' 3 4" E 565. 0 0'N3 8 ° 3 3 ' 2 6 "W 2 2 0 . 0 0 ' S51° 2 6' 3 4" W 80.0 0'N3 8 ° 3 3 ' 2 6 "W 1 9 6 . 7 4 ' N51° 2 5' 3 5" E 114. 3 3'S3 8 ° 3 4 ' 1 9 "E 1 5 9 . 5 8 ' N51° 2 5' 4 1" E 226. 9 2'S3°37'47"E1044.45'N89°50'53"W 317.33' S51° 2 6' 3 4" W 65.8 5'N3 8 ° 3 3 ' 2 6 "W 1 9 0 . 0 0 ' S51° 2 6' 3 5" W 20.0 0'N3 8 ° 3 3 ' 2 6 "W 2 0 5 . 0 0 ' W. SO U T H L A K E B L V D (F.M . H W Y N O . 1 7 0 9 ) (VA R I A B L E W I D T H R O W ) LOT 4, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 1614, P.R.T.C.T.) SLM DUNHILL LLC, ZONING C-3 L.U.D. = RETAIL COMMERCIAL EX. BUILDING ZONING C-3 5,000 SF EX. SIDEWALK EX. SIDEWALK EX. SIDEWALK EX. SIDEWALK EX. CROSS WALK EX. CROSS WALK PROP. BUILDING ZONING C-3 2,605 SF EX. SIDEWALK PROP. CROSS WALK EX. SIDEWALK PROP. SIDEWALK LEGEND 2 FILENAME: PEDESTRIAN ACCESS PLAN_SHP22002.dwgPLOTTED BY: Sydney FosterFULL PATH: K:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site PlanK:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site Plan\PEDESTRIAN ACCESS PLAN_SHP22002PLOTTED DATE: 9/13/2023PEDESTRIAN ACCESS PLAN GRAPHIC SCALE FEET012060 SCALE: 1" = 60' FIRE LANE STRIPING ACCESSIBLE ROUTE PARKING COUNT PROPERTY BOUNDARY FIRELANE 10 KE PROJECT CLIENT LOGO 4809 COLE AVE #330 DALLAS, TX 75205 214-960-4545 SHEET:REV:DATE:DESCRIPTION:SOUTHLAKEMARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXASKIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 TEXAS FIRM NO. 15874 JOB NUMBER: ISSUE DATE: SHP22002 9/13/2023 E N G I N E E R I N G P R E L I M I N A R Y F O R R E V I E W O N L Y T H E S E D O C U M E N T S A R E F O R D E S I G N R E V I E W O N L Y A N D N O T I N T E N D E D F O R T H E PURPOSES OF CONSTRUCTION, B I D D I N G O R P E R M I T . T H E Y W E R E P R E P A R E D B Y , O R UN DE R THE S U P ER VI S IO N OF : P.E.# 91865 SHEA O. KIRKMAN DATE: September 13, 2023 ZA23-0008 PLAYERS CIRCLE ADDITION CABINET A, SLIDE 10975 P.R.T.C.T. 250 PLAYER CIRCLE LLC, ZONING C-3 L.U.D. = RETAIL COMMERCIAL LOT 5, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 6, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 8, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) SL MARKETPLACE PARTNERS LP, ZONING C-3 L.U.D. = RETAIL COMMERCIAL TRACT 3 LOT 2R, BLOCK 1, SOUTHLAKE CROSSING PHASE I (CABINET A, SLIDE 1613, P.R.T.C.T.) TRACT 3 LOT 2R, BLOCK 1, SOUTHLAKE CROSSING PHASE I (CABINET A, SLIDE 1613, P.R.T.C.T.) STORE MASTER FUNDING XIV LLC, ZONING SP1 L.U.D. = RETAIL COMMERCIAL LOT 7, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) 30' S E T B A C K (PER Z O NI N G) 30' S E T B A C K (PER Z O NI N G) N51° 2 6' 3 4" E 565. 0 0'N3 8 ° 3 3 ' 2 6 "W 2 2 0 . 0 0 ' S51° 2 6' 3 4" W 80.0 0'N3 8 ° 3 3 ' 2 6 "W 1 9 6 . 7 4 ' N51° 2 5' 3 5" E 114. 3 3'S3 8 ° 3 4 ' 1 9 "E 1 5 9 . 5 8 ' N51° 2 5' 4 1" E 226. 9 2'S3°37'47"E1044.45'N89°50'53"W 317.33' S51° 2 6' 3 4" W 65.8 5'N3 8 ° 3 3 ' 2 6 "W 1 9 0 . 0 0 ' S51° 2 6' 3 5" W 20.0 0'N3 8 ° 3 3 ' 2 6 "W 2 0 5 . 0 0 ' W. SO U T H L A K E B L V D (F.M . H W Y N O . 1 7 0 9 ) (VA R I A B L E W I D T H R O W ) LOT 4, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 1614, P.R.T.C.T.) SLM DUNHILL LLC, ZONING C-3 L.U.D. = RETAIL COMMERCIAL 3 FILENAME: EX OPEN SPACE MANAGEMENT PLAN_SHP22002.dwgPLOTTED BY: Sydney FosterFULL PATH: K:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site PlanK:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site Plan\EX OPEN SPACE MANAGEMENT PLAN_SHP22002PLOTTED DATE: 9/13/2023EXISTING OPEN SPACE GRAPHIC SCALE FEET012060 SCALE: 1" = 60' KE PROJECT CLIENT LOGO 4809 COLE AVE #330 DALLAS, TX 75205 214-960-4545 SHEET:REV:DATE:DESCRIPTION:SOUTHLAKEMARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXASKIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 TEXAS FIRM NO. 15874 JOB NUMBER: ISSUE DATE: SHP22002 9/13/2023 E N G I N E E R I N G P R E L I M I N A R Y F O R R E V I E W O N L Y T H E S E D O C U M E N T S A R E F O R D E S I G N R E V I E W O N L Y A N D N O T I N T E N D E D F O R T H E PURPOSES OF CONSTRUCTION, B I D D I N G O R P E R M I T . T H E Y W E R E P R E P A R E D B Y , O R UN DE R THE S U P ER VI S IO N OF : P.E.# 91865 SHEA O. KIRKMAN DATE: September 13, 2023 LEGEND EXISTING OPEN SPACE TO BE REMOVED EXISTING OPEN SPACE TO REMAIN EXISTING SITE PLAN DATA TABLE EXISTING ZONING C-3 TOTAL NUMBER OF PROPOSED LOTS 3 TOTAL LOT AREA (SF) / (ACRES)544,897 / 12.509 LOT 5 400,898 / 9.203 LOT 6 37,618 / 0.863 LOT 7 106,381 / 2.442 AREA OF EX. OPEN SPACE (SF)120,314 PERCENTAGE OF OPEN SPACE (%)22.08% REQUIRED PARKING 642 PROVIDED PARKING STANDARD 540 HANDICAP 21 TOTAL 561 EXISTING BUILDING AREA (SF)109,478 MAXIMUM BUILDING HEIGHT 47'-6" (1 STORY) # OF STORIES 1 BUILDING LOT COVERAGE (%) / FLOOR AREA RATIO 20.0% / 0.20:1 IMPERVIOUS COVERAGE (SF) / (%)424,583 / 77.92% ANTICIPATED SCHEDULE OF DEVELOPMENT SPRING 2024 ZA23-0008 EX. BUILDING ZONING C-3 71,301 SF EX. BUILDING ZONING C-3 15,561 SF EX. BUILDING ZONING C-3 20,236 SF DRIVETHRU ELEC MAI N SIG N S M S P P P F P F WVWV SS FH WM CO CO CO COCO ELEC ELEC ELEC CO CO CO CO COCO CO CO COCO CO COCO SS SS SSCO CO ELEC ELEC FH FH FH WV WV WVWV WV FH WV WV WVWV WV WV WV ELEC LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP WV WV WV WM WMWM WM WM GM GM ELEC FH ELEC LP LP ELECELEC LP FH SS SS COCO CO CO CO ELEC ELEC LP TELE WM WM WM SD SD SD ELEC WM ELEC WM WM WM ELEC ELEC ELEC ELEC ELEC SDSD EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R PLAYERS CIRCLE ADDITION CABINET A, SLIDE 10975 P.R.T.C.T. 250 PLAYER CIRCLE LLC, ZONING C-3 L.U.D. = RETAIL COMMERCIAL LOT 5, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 6, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 8, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) SL MARKETPLACE PARTNERS LP, ZONING C-3 L.U.D. = RETAIL COMMERCIAL TRACT 3 LOT 2R, BLOCK 1, SOUTHLAKE CROSSING PHASE I (CABINET A, SLIDE 1613, P.R.T.C.T.) TRACT 3 LOT 2R, BLOCK 1, SOUTHLAKE CROSSING PHASE I (CABINET A, SLIDE 1613, P.R.T.C.T.) STORE MASTER FUNDING XIV LLC, ZONING SP1 L.U.D. = RETAIL COMMERCIAL LOT 7, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) 30' S E T B A C K (PER Z O NI N G) 30' S E T B A C K (PER Z O NI N G) N51° 26' 3 4" E 565. 0 0'N3 8 ° 3 3 ' 2 6 "W 2 2 0 . 0 0 ' S51° 2 6' 3 4" W 80.0 0'N3 8 ° 3 3 ' 2 6 "W 1 9 6 . 7 4 ' N51° 2 5'3 5" E 114. 3 3'S3 8 ° 3 4 ' 1 9 "E 1 5 9 . 5 8 ' N51°2 5' 4 1" E 226. 9 2'S3°37'47"E1044.45'N89°50'53"W 317.33' S51° 2 6' 3 4" W 65.85'N3 8 ° 3 3 ' 2 6 "W 1 9 0 . 0 0 ' S51° 2 6'3 5" W 20.0 0'N3 8 ° 3 3 ' 2 6 "W 2 0 5 . 0 0 ' W. SO U T H L A K E B L V D (F.M . H W Y N O . 1 7 0 9 ) (VA R I A B L E W I D T H R O W ) LOT 4, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 1614, P.R.T.C.T.) SLM DUNHILL LLC, ZONING C-3 L.U.D. = RETAIL COMMERCIAL PROP. BUILDING ZONING C-3 2,605 SF EX. BUILDING ZONING C-3 5,000 SF 4 FILENAME: PROP OPEN SPACE MANAGEMENT PLAN_SHP22002.dwgPLOTTED BY: Sydney FosterFULL PATH: K:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site PlanK:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site Plan\PROP OPEN SPACE MANAGEMENT PLAN_SHP22002PLOTTED DATE: 9/13/2023PROPOSED OPEN SPACE GRAPHIC SCALE FEET012060 SCALE: 1" = 60' KE PROJECT CLIENT LOGO 4809 COLE AVE #330 DALLAS, TX 75205 214-960-4545 SHEET:REV:DATE:DESCRIPTION:SOUTHLAKEMARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXASKIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 TEXAS FIRM NO. 15874 JOB NUMBER: ISSUE DATE: SHP22002 9/13/2023 E N G I N E E R I N G P R E L I M I N A R Y F O R R E V I E W O N L Y T HE S E D O C U M EN TS AR E F OR D E S I G N R E V I E W O N L Y A N D N O T I N T E N D E D F O R T H E PURPOSES OF CONSTRUCTION, B I D D I N G O R P E R M I T . T H E Y W E R E P R E P A R E D B Y , O R U ND ER TH E S UPE R VISI ON O F : P.E.# 91865 SHEA O. KIRKMAN DATE: September 13, 2023 LEGEND PROPOSED OPEN SPACE PROPOSED PATIO AREA EXISTING OPEN SPACE TO REMAIN SITE PLAN DATA TABLE EXISTING ZONING C-3 PROPOSED ZONING SP-1 TOTAL NUMBER OF PROPOSED LOTS 3 TOTAL LOT AREA (SF) / (ACRES)544,897 / 12.509 LOT 5 400,898 / 9.203 LOT 6 37,618 / 0.863 LOT 7 106,381 / 2.442 AREA OF OPEN SPACE (SF)120,350 PERCENTAGE OF OPEN SPACE (%)22.09% REQUIRED PARKING 662 PROVIDED PARKING STANDARD 553 HANDICAP 25 TOTAL 578 TOTAL BUILDING AREA (SF)112,083 MAXIMUM BUILDING HEIGHT 47'-6" (1 STORY) # OF STORIES 1 BUILDING LOT COVERAGE (%) / FLOOR AREA RATIO 20.57% / 0.206:1 IMPERVIOUS COVERAGE (SF) / (%)424,547 / 77.91% ANTICIPATED SCHEDULE OF DEVELOPMENT SPRING 2024 ZA23-0008 2222333333441116661094111111111212883466SHEET TITLE:DRAWN BY:CHK'D BY:DESCRIPTIONDATESEAL:ISSUES / REVISIONS:PROJECT NO:THESE PLANS ARE THE PROPERTY OF MRP DESIGN GROUP, INC. AND ARE SUBJECT TO FEDERAL COPYRIGHT LAWS. ANY USE OF SAME WITHOUT THE EXPRESS WRITTEN PERMISSION OF MRP DESIGN GROUP, INC. IS STRICTLY PROHIBITED P. 770-917-9172Building 100, Suite 120Kennesaw, Georgia 30144www.mrpdesign.comF. 770-917-94703450 Acworth Due West RoadPROJECT DESCRIPTION:BIRDCALLPRELIMINARYNOT RELEASED FORCONSTRUCTION23042PROJECT TITLE:ARCHITECT OF RECORD:BIRDCALL SOUTHLAKE, TX THOMAS E. MORGAN, JR.ARCHITECT423 FISCHER TRAILELLIJAY, GEORGIA 30540ELEVATIONSA101ESCALE: 3/16"=1'-0"ARCHITECTURAL ELEVATION 1A1013ESCALE: 3/16"=1'-0"ARCHITECTURAL ELEVATION 4A1011ESCALE: 3/16"=1'-0"ARCHITECTURAL ELEVATION 3A1012ESCALE: 3/16"=1'-0"ARCHITECTURAL ELEVATION 2A101412WALL TILEHARD COAT STUCCO, COLOR WHITE3PRE-FINISHED METAL COPING, COLOR: WHITE56ALUMINUM STOREFRONT FRAME. COLOR WHITEELEVATION KEY NOTES8NOT USEDALUMINUM RAILINGS. COLOR WHITE4ALUMINUM FRAMED CANOPY. COLOR SAME AS TILE10DRIVE-THRU WINDOW79METAL DOOR. COLOR WHITE11EXTERIOR LIGHTING SCONCES12PAINTED MURAL2HARD COAT STUCCO, COLOR WHITE 866 SF = 76%ELEVATION MATERIALS PERCENTAGESELEVATION 1TOTAL ELEVATION SQUARE FEET: 1,1381WALL TILE84 SF = 7.4%COOLER METAL PANEL PAINTED WHITE96 SF = 8.4%2HARD COAT STUCCO, COLOR WHITE 262 SF = 41.6%ELEVATION 3TOTAL ELEVATION SQUARE FEET: 6291WALL TILE144 SF = 22.9%2HARD COAT STUCCO, COLOR WHITE 521 SF = 45.8%ELEVATION 2TOTAL ELEVATION SQUARE FEET: 1,1381WALL TILE233 SF = 20.4%2HARD COAT STUCCO, COLOR WHITE316 SF = 50.2%ELEVATION 4TOTAL ELEVATION SQUARE FEET: 629COOLER METAL PANEL PAINTED WHITE96 SF = 8.4%COOLER METAL PANEL PAINTED WHITE313 SF = 49.8%17'-0"17'-0"17'-0"17'-0"9'-0"10'-8"10'-8"10'-8"9'-0"9'-0"0'-0"0'-0"0'-0"0'-0"NOT USEDZA23-0008 ORDER & MENU BOARDPUTTINGGREENKITCHENDININGBARCOOLERWOMEN'SRESTROOMMEN'SRESTROOMDISHWASHINGELECTRICALGAMESCUBBIESFREEZER66 SEATSPATIO40 SEATSMGR.OFFICETRASHSTRINGLIGHTSSTRINGLIGHTSTRASH UNITRECYCLINGTRASH UNITRECYCLINGUNDERCOUNTERTRASH UNITRECYCLINGSTRINGLIGHTSSTRINGLIGHTSDRIVE-THRUGARAGEDOOROILRECLAMATIONSYSTEM21432,143 SFSHEET TITLE:DRAWN BY:CHK'D BY:DESCRIPTIONDATESEAL:ISSUES / REVISIONS:PROJECT NO:THESE PLANS ARE THE PROPERTY OF MRP DESIGN GROUP, INC. AND ARE SUBJECT TO FEDERAL COPYRIGHT LAWS. ANY USE OF SAME WITHOUT THE EXPRESS WRITTEN PERMISSION OF MRP DESIGN GROUP, INC. IS STRICTLY PROHIBITED P. 770-917-9172Building 100, Suite 120Kennesaw, Georgia 30144www.mrpdesign.comF. 770-917-94703450 Acworth Due West RoadPROJECT DESCRIPTION:BIRDCALLPRELIMINARYNOT RELEASED FORCONSTRUCTION23042PROJECT TITLE:ARCHITECT OF RECORD:BIRDCALL SOUTHLAKE, TX THOMAS E. MORGAN, JR.ARCHITECT423 FISCHER TRAILELLIJAY, GEORGIA 305403/16" = 1'-0"ARCHITECTURAL FLOOR PLANA1001 FLOOR PLANA100ZA23-0008 ELEC P P P F P F WVWV SS FH WM CO CO CO COCO ELEC ELEC ELEC CO CO CO CO CO CO CO CO COCO CO COCO SS SS SSCO CO ELEC ELEC FH FH FH WV WV WVWV WV FH WV WV WVWV WV WV WV ELEC LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP WV WV WV WM WMWM WM WM GM GM ELEC FH ELEC LP LP ELECELEC FH SS SS COCO CO CO CO ELEC ELEC TELE WM WM WM SD SD ELEC WM ELEC WM WM WM ELEC ELEC ELEC ELEC ELEC SD SD EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R UC4 (TYP. OF 7) VM VM UC4 (TYP. OF 7) VM UC2 (TYP. OF 7) LM UC2 VA (TYP. OF 6) UP4 (TYP. OF 4) TURF LI (TYP. OF 3) RH NT UC2 NT RH LI (TYP. OF 3) UC2 (TYP. OF 2) UC2 LM LI (TYP. OF 3) UC2 LM LI (TYP. OF 3) LM UC4 NE UP2 MC LM NE MC UP2 UP4 LM LI (TYP. OF 3) MC UP4 LM NT YR AG IC NE HPA CS LF VA (TYP. OF 3) CT TURF UP2 (TYP. OF 7) SG AG LM SCPROPE RTY LI N E PRO P ER T Y L INE PROPERTY LINE PROPERTY LINEPROP ER TY L IN EPROP ER T Y L INE W. S O UT HLAKE B O ULEVA R D PROPOSED OPEN SPACE 15'-0" UTILITY EASEMENT 35'-0" UTILITY EASEMENT 40'-0" PERIMETER DRIVE ACCESS EASEMENT 48'-0" DRAINAGE EASEMENT 40'-0" PERIMETER DRIVE ACCESS EASEMENT 15'-0" UTILITY EASEMENT 20'-0" DRAINAGE EASEMENT LOT 7, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 6, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 5, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) PROPOSED BUILDING TRASH ENCLOSURE SOUTHLAKE MARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXAS21020 JULY 31, 2023 LANDSCAPE PLAN Kirkman Engineering 5200 State Highway 121 Colleyville, TX 76034 CIVIL ENGINEER SHOP Companies 4809 Cole Ave, Suite 330 Dallas, TX 75205 OWNER IHAL L CEE MKV U L I CHHISTEC CTTESAETST AIREG 83 O F 5 2 ET XR LDRE CAANDS EP A 07/31/2023 CASE NO. ZA23-0008 Rev: Drawing name: O:\04-Projects\21020 - Southlake Shopping Center\01 Zoning\04 CAD\02 Sheets\01-Zoning\21020-L1-zoning.dwg L2 Jul 31, 2023 3:33pm by: elevkulichProject Number: Bud Creative, LLC 3800 Main Street, Suite B Dallas, Texas 75226 P: 570.954.1964 Date: Issue: Sheet Title: Sheet Number: Date:Description: L2 NOTE: PER ZONING SEC. 42.2. BUFFERYARDS ARE NOT REQUIRED FOR NEW BUILDINGS LESS THAN 5,000 SF. ALL LANDSCAPED AREAS MUST BE IRRIGATED BY AN AUTOMATIC UNDERGROUND IRRIGATION SYSTEM EQUIPPED WITH OPERATING RAIN AND FREEZE SENSORS THE OWNER SHALL BE RESPONSIBLE FOR THE CONTINUED MAINTENANCE IN PERPETUITY OF ALL LANDSCAPING AND IRRIGATION. ALL REQUIRED LANDSCAPING SHALL BE MAINTAINED IN A NEAT AND ORDERLY MANNER AT ALL TIMES. THIS SHALL INCLUDE MOWING, EDGING, PRUNING, FERTILIZING, WATERING, WEEDING, KEEPING BEDS MULCHED IN ACCORDANCE WITH STANDARD HORTICULTURAL PRACTICES OR AS RECOMMENDED BY THE LANDSCAPE ADMINISTRATOR AND OTHER SUCH ACTIVITIES COMMON TO THE MAINTENANCE OF LANDSCAPING. LANDSCAPED AREAS SHALL BE KEPT FREE OF TRASH, LITTER; WEEDS AND OTHER SUCH MATERIAL OR PLANTS NOT A PART OF THE LANDSCAPING. ALL PLANT MATERIALS SHALL BE MAINTAINED IN A HEALTHY AND GROWING CONDITION AS IS APPROPRIATE FOR THE SEASON OF THE YEAR. ALL IRRIGATION HEADS OR LINES WHICH ARE BROKEN AND FLOW WATER SHALL BE REPLACED/REPAIRED IMMEDIATELY TO PREVENT THE WASTE OF WATER. N O R T H 120'60'30' SCALE: 1"=60' 0' LANDSCAPE PLAN1 LANDSCAPE PLAN 36" MIN.SOIL DEPTH1'-0"MIN. CUT ALL ROPES, WIRES, AND BURLAP FROM TRUNK AND REMOVE TOP OF ROOT BALL. REMOVE ALL CONTAINERS FROM ROOT BALL. 3" LAYER OF SPECIFIED MULCH 3" HIGH EARTHEN WATER RETENTION BASIN FINISHED GRADE ROOTBALL ANCHOR RINGS NAIL STAKE SPECIFIED SOIL BACKFILL MIX UNDISTURBED SUBGRADE TOP OF ROOT BALL TO BE 2" ABOVE FINISHED GRADE. MULCH TO BE NO DEEPER THAN 2" WITHIN 6" OF TREE TRUNK SAFETY STAKE BY ARBOR STAKES, SIZE PER CONTAINER/ ROOT BALL SIZE, REF. MANUFACTURER SPECIFICATIONS 1'-0"MIN.DEPTH OFROOTBALLTOP OF ROOT BALL TO BE 2" ABOVE FINISHED GRADE. MULCH TO BE NO DEEPER THAN 2" WITHIN 6" OF TREE TRUNK SAFETY STAKE BY ARBOR STAKES, SIZE PER CONTAINER/ ROOT BALL SIZE, REF. MANUFACTURER SPECIFICATIONS CUT ALL ROPES, WIRES, AND BURLAP FROM TRUNK AND REMOVE TOP OF ROOT BALL. REMOVE ALL CONTAINERS FROM ROOT BALL. 3" LAYER OF SPECIFIED MULCH 3" HIGH EARTHEN WATER RETENTION BASIN FINISHED GRADE ROOTBALL ANCHOR RINGS SPECIFIED SOIL BACKFILL MIX UNDISTURBED SUBGRADE NAIL STAKE 1 1/2"1/2" MAXIMUMABOVE MULCHCOMPACTED SOIL ADJACENT TO EDGING 3" LATER OF SPECIFIED MULCH SPECIFIED SOIL BACKFILL MIX FINISHED GRADE SUBGRADE METAL EDGING TOP OF ROOTBALL TO BE 1" ABOVE FINISHED GRADE FILL BED WITH MINIMUM 3" LAYER OF SPECIFIED MULCH, TAPER MULCH AWAY FROM TRUNK DEPTH PERSPECIFICATIONSFINISHED GRADE SPECIFIED PLANTING MIX REMOVE CONTAINER AND ANY WRAPPING, TWINE, WIRES, ETC. UNDISTURBED SUBGRADE ON CENTER SPACING PER PLANT LIST 1.THE CONTRACTOR SHALL FURNISH QUANTITIES NECESSARY TO COMPLETE THE PLANTING AS SHOWN ON THE PLANTING PLANS. A. ALL PLANTS SHALL EQUAL OR EXCEED MEASUREMENTS SPECIFIED IN THE PLANT LIST WHICH ARE THE MINIMUM ACCEPTABLE. B. PLANTS SHALL BE MEASURED BEFORE PRUNING. NECESSARY PRUNING SHALL BE PERFORMED AFTER THE PLANT IS UNTIED AND PRIOR TO INSTALLATION. LANDSCAPE ARCHITECT SHALL BE NOTIFIED OF ANY MAJOR PRUNING REQUIREMENTS DUE TO DAMAGE. THE LANDSCAPE ARCHITECT RESERVES THE RIGHT TO REJECT ANY PLANT MATERIAL THAT NEEDS SIGNIFICANT PRUNING DUE TO DAMAGE FROM SHIPMENT OR HANDLING. C. WHEN FORMAL ARRANGEMENTS OR CONSECUTIVE ORDER OF TREES OR SHRUBS IS SHOWN, STOCK SHALL BE SELECTED FOR UNIFORM HEIGHT AND SPREAD AND LABELED BY NUMBER TO ASSURE SYMMETRY IN PLANTING. 2.TREE TAGGING: THE LANDSCAPE ARCHITECT MAY ELECT TO REVIEW THE TREES AT THE PLACE OF GROWTH FOR THE PURPOSE OF SELECTION FOR THE PROJECT. WHEN ALL PLANT MATERIAL HAS BEEN SELECTED AND PRE-TAGGED BY THE LANDSCAPE CONTRACTOR, THE LANDSCAPE ARCHITECT SHALL BE NOTIFIED IN ORDER TO SCHEDULE HIS NURSERY INSPECTION WITH A MINIMUM OF 3 DAYS ADVANCE NOTICE. A. THE CONTRACTOR SHALL ACCOMPANY THE LANDSCAPE ARCHITECT ON ALL INSPECTIONS. B. THE CONTRACTOR SHALL HAVE SUFFICIENT ALTERNATE CHOICES TO PREVENT LOSS OF TIME IN THE EVENT THAT SOME TREES FAIL TO MEET THE APPROVAL OF THE LANDSCAPE ARCHITECT. C. ALL TREES MUST BE APPROVED IN THE FIELD BY THE LANDSCAPE ARCHITECT BEFORE DIGGING BEGINS. 3.IF IT IS DETERMINED THAT TREE TAGGING WILL NOT TAKE PLACE, THE CONTRACTOR IS RESPONSIBLE TO SUBMIT REPRESENTATIVE PHOTOGRAPHS FOR REVIEW OF ALL PLANT MATERIALS AT THE SPECIFIED SIZES OR GREATER. ALL PHOTOS MUST INCLUDE A MEASURING DEVICE THAT IS CLEARLY LEGIBLE WITH PLANT COMMON NAME, BOTANICAL NAME, AND SUPPLIER INFORMATION. 4.LOCATIONS OF PLANT MATERIAL SHOWN ON PLANS ARE APPROXIMATE. FINAL LOCATIONS WILL VARY FROM PLAN AND SHALL BE DETERMINED IN THE FIELD UNDER THE DIRECTION OF THE LANDSCAPE ARCHITECT. A. CONTRACTOR SHALL PROVIDE PRE-MARKED, COLOR-CODED FLAGS FOR ALL SHADE TREES, EVERGREEN TREES AND FLOWERING TREES. B. LANDSCAPE ARCHITECT SHALL PLACE THE COLOR-CODED FLAGS TO INDICATE PLANT LOCATIONS. C. CONTRACTOR SHALL PLACE TREES ABOVE GROUND IN ACCORDANCE WITH THE FLAGGED LOCATION. THE LANDSCAPE ARCHITECT MAY REQUEST THE CONTRACTOR TO MOVE, TURN OR RELOCATE THE PLANT MATERIAL AT THIS TIME. UNDER NO CIRCUMSTANCES SHALL THE CONTRACTOR PRE-DIG TREE PITS. D. UPON FINAL APPROVAL BY THE LANDSCAPE ARCHITECT OF TREE PLACEMENT, CONTRACTOR SHALL PAINT A CIRCLE AROUND THE BALL OF THE TREE, MOVE TREE AND EXCAVATE TREE PIT. PLANTING NOTES: 5.PLANTS SHALL BE TYPICAL OF THEIR SPECIES AND VARIETY; HAVE NORMAL GROWTH HABITS; WELL DEVELOPED BRANCHES, DENSELY FOLIATED; VIGOROUS ROOT SYSTEMS, BE FREE FROM DEFECTS AND INJURIES AND COMPLY WITH ANY SPECIAL INSTRUCTIONS NOTED WITHIN THE PLANT LIST. 6.PLANT MATERIAL SHALL BE PLANTED ON THE DAY OF DELIVERY. IN THE EVENT THIS IS NOT POSSIBLE, THE CONTRACTOR SHALL PROTECT PLANT STOCK WHICH HAS NOT BEEN PLANTED. PLANTS SHALL NOT REMAIN UNPLANTED FOR LONGER THAN A THREE DAY PERIOD AFTER DELIVERY. 7.QUALITY, BRANCHING AND SIZE OF PLANTS, INCLUDING ROOT SIZE, SHALL BE IN ACCORDANCE WITH "AMERICAN STANDARDS FOR NURSERY STOCK" ANSI Z60 .1-2014 (MOST RECENT EDITION) AS PUBLISHED BY THE AMERICAN NURSERY AND LANDSCAPE ASSOCIATION. 8.B&B PLANTS SHALL BE HANDLED FROM THE BOTTOM OF THE ROOT BALL ONLY. PLANTS WITH BROKEN, SPLIT OR DAMAGED ROOT BALLS SHALL BE REJECTED. 9.ALL PLANTING BEDS SHALL BE MULCHED TO A DEPTH OF 3 INCHES WITH FINE GROUND, SHREDDED HARDWOOD BARK MULCH; DOUBLE-SHREDDED, AND FREE OF GROWTH OR GERMINATION INHIBITING INGREDIENTS. . MULCH SHOULD NOT COME INTO CONTACT WITH THE ROOT COLLAR OF TREES OR SHRUBS. THE TOP OF THE ROOT BALL FOR ALL B&B PLANTS SHALL BE EXCAVATED TO EXPOSE THE ROOT FLARE. THE ROOT FLARE SHALL BE AT THE TOP OF THE BALL AND PLANTED LEVEL OR 1" ABOVE FINISHED GRADE. 10.THE LAYOUT OF ALL BEDLINES SHALL BE APPROVED BY THE LANDSCAPE ARCHITECT ON-SITE PRIOR TO INSTALLING 11.THE CONTRACTOR SHALL BE RESPONSIBLE FOR ALL UTILITY MARK OUTS AND COMPLIANCE WITH ALL FEDERAL, STATE OR LOCAL CODES, LAWFUL ORDERS OR REGULATIONS GOVERNING UPON THIS WORK. 12.THE CONTRACTOR SHALL BE RESPONSIBLE FOR THE PROPER INSTALLATION AND MAINTENANCE OF ALL TREE GUYS, STAKES, SUPPORTS AND MULCH RINGS OR BEDS DURING THE CONSTRUCTION AND MAINTENANCE PERIOD. 13.THE CONTRACTOR SHALL REPORT ANY SOIL OR DRAINAGE CONDITIONS CONSIDERED DETRIMENTAL TO THE GROWTH OF THE PROPOSED PLANT MATERIAL. TREES SHALL BE PRUNED OF ANY BRANCHES THAT INTERFERE WITH PEDESTRIANS, VEHICLES OR SIGNS. SHADE TREES MUST BE SINGLE TRUNK, TREE FORM SPECIMENS. ALL PARKING LOT AND STREET TREES SHALL BE LIMBED TO A HEIGHT OF SEVEN FEET. 14.ANY DISCREPANCY BETWEEN THE PLANS AND FIELD CONDITIONS SHALL BE RESOLVED BY THE LANDSCAPE ARCHITECT IN THE FIELD. 15.PLANTING OPERATIONS SHALL BE PERFORMED DURING PERIODS WITHIN THE PLANTING SEASON WHEN WEATHER AND SOIL CONDITIONS ARE SUITABLE AND IN ACCORDANCE WITH ACCEPTABLE LOCAL PRACTICE.SOUTHLAKE MARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXAS21020 JULY 31, 2023 LANDSCAPE PLAN Kirkman Engineering 5200 State Highway 121 Colleyville, TX 76034 CIVIL ENGINEER SHOP Companies 4809 Cole Ave, Suite 330 Dallas, TX 75205 OWNER IHAL L CEE MKV U L I CHHISTEC CTTESAETST AIREG 83 O F 5 2 ET XR LDRE CAANDS EP A 07/31/2023 CASE NO. ZA23-0008 Rev: Drawing name: O:\04-Projects\21020 - Southlake Shopping Center\01 Zoning\04 CAD\02 Sheets\01-Zoning\21020-L1-zoning.dwg L3 Jul 31, 2023 3:33pm by: elevkulichProject Number: Bud Creative, LLC 3800 Main Street, Suite B Dallas, Texas 75226 P: 570.954.1964 Date: Issue: Sheet Title: Sheet Number: Date:Description: L3 NOT TO SCALE STANDARD TRUNK TREE PLANTING SECTION1 NOT TO SCALE MULTI-TRUNK TREE PLANTING SECTION2 NOT TO SCALE METAL EDGING SECTION4 NOT TO SCALE SHRUB BED PLANTING SECTION3 PLANTING DETAILS ELECPP P F P F WVWVSSFHWMCOCOCOCOCOELECELECELECCOCOCOCOCOCOCOCOCOCOCOCOCOSSSSSSCOCOELECELECFHFHFHWVWVWVWVWVFHWVWVWVWVWVWVWVELECLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPLPWVWVWVWMWMWMWMWMGMGMELECFHELECLPLPELECELECLPFHSSSSCOCOCOCOCOELECELECLPTELEWMWMWMSDSDSDELECWMELECWMWMWMELECELECELECELECELECSDSDEX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR W. SOUTHLAKE BLVD (F.M. HWY NO. 1709) (VARIABLE WIDTH ROW ) 8 10 11 660665655650 665 660670 665 674669657 663662661659658666667668 656 EX. BLDG EX. FFE=663.4 EX. BLDG EX. FFE=670.1 EX. BLDG EX. FFE=665.6 EX. BLDG EX. FFE=654.3 EX. BLDG EX. FFE=659.6 FFE= 663.4 660656 6625 FILENAME: PGP1.0 PRELIMINARY GRADING PLAN_SHP22002.dwgPLOTTED BY: Sydney FosterFULL PATH: K:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site PlanK:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site Plan\PGP1.0 PRELIMINARY GRADING PLAN_SHP22002PLOTTED DATE: 9/13/2023SITE BENCHMARKS ALL EVELATIONS ARE BASED ON CITY OF SOUTHLAKE BM NO. 33 LOCATED AT LAT. 32°56'30.52072"N, LONG. 97°11"07.20706"W ALUMINUM MONUMENT IN CONCRETE. ELEVATION = 657.38' (NAD '83) KE PROJECT CLIENT LOGO 4809 COLE AVE #330 DALLAS, TX 75205 214-960-4545 SHEET:REV:DATE:DESCRIPTION:SOUTHLAKEMARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXASKIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 TEXAS FIRM NO. 15874 JOB NUMBER: ISSUE DATE: SHP22002 9/13/2023 E N G I N E E R I N G P R E L I M I N A R Y F O R R E V I E W O N L Y T H E S E D O C U M E N T S A R E F O R D E S I G N R E V I E W O N L Y A N D N O T I N T E N D E D F O R T H E PURPOSES OF CONSTRUCTION, B I D D I N G O R P E R M I T . T H E Y W E R E P R E P A R E D B Y , O R UN DE R THE S U P ER VI S IO N OF : P.E.# 91865 SHEA O. KIRKMAN DATE: September 13, 2023 OVERALL GRADING PLANGRAPHIC SCALE FEET012060 SCALE: 1" = 60' Know what's below. before you dig.Call R LEGEND PROPOSED CONTOUR EXISTING CONTOUR GRADE BREAK PROPOSED SWALE PROPOSED FINISHED GRADE PROPOSED TOP OF CURB/GUTTER PROPOSED TOP OF WALL/ BOTTOM OF WAL PROPOSED TOP OF INLET EXISTING SPOT GRADE EXISTING TOP OF CURB/GUTTER PROPOSED DRAINAGE FLOW ARROW EXISTING DRAINAGE FLOW ARROW PROPERTY BOUNDARY 500 500 FG 700.00 TC 700.50 G 700.00 TW 700.00 BW 699.00 TI 700.00 EX. 700.5± TC 700.5± G 700.0± ZA23-0008 LPLPLPLP30' SETBACK (PER ZONING) PROP. PATIO 924 SF PROP. BUILDING 2,605 SF PUTTING GREEN 662 6636616606596586 5 9657656 66166065965865765666266 3 662 661660659658657656655654 6606 5 9 6586 5 7 658 657 656 660661663662FFE=660.40 G 662.20 TC 662.70 G 662.92 TC 663.42 G 662.41 TC 662.91 G 661.86 TC 662.36 G 659.78 TC 660.28 G 659.54 TC 660.04 G 660.00 TC 660.50 G 660.12 TC 660.62 G 659.00 TC 659.50 G 660.41 TC 660.91 G 657.72 TC 658.22 G 658.05 TC 658.55 G 657.00 TC 657.50 G 656.63 TC 657.13 EX. 662.0± EX. 662.2± EX. 659.9±EX. 659.5± EX. 657.2±EX. 656.3± FG 658.54 FG 659.02FG 658.71 EX. 656.7±EX. 655.8± 6 FILENAME: PGP1.0 PRELIMINARY GRADING PLAN_SHP22002.dwgPLOTTED BY: Sydney FosterFULL PATH: K:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site PlanK:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site Plan\PGP1.0 PRELIMINARY GRADING PLAN_SHP22002PLOTTED DATE: 9/13/2023SITE BENCHMARKS ALL EVELATIONS ARE BASED ON CITY OF SOUTHLAKE BM NO. 33 LOCATED AT LAT. 32°56'30.52072"N, LONG. 97°11"07.20706"W ALUMINUM MONUMENT IN CONCRETE. ELEVATION = 657.38' (NAD '83) KE PROJECT CLIENT LOGO 4809 COLE AVE #330 DALLAS, TX 75205 214-960-4545 SHEET:REV:DATE:DESCRIPTION:SOUTHLAKEMARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXASKIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 TEXAS FIRM NO. 15874 JOB NUMBER: ISSUE DATE: SHP22002 9/13/2023 E N G I N E E R I N G P R E L I M I N A R Y F O R R E V I E W O N L Y T H E S E D O C U M E N T S A R E F O R D E S I G N R E V I E W O N L Y A N D N O T I N T E N D E D F O R T H E PURPOSES OF CONSTRUCTION, B I D D I N G O R P E R M I T . T H E Y W E R E P R E P A R E D B Y , O R UN DE R THE S U P ER VI S IO N OF : P.E.# 91865 SHEA O. KIRKMAN DATE: September 13, 2023 DETAILED GRADING PLANGRAPHIC SCALE FEET02010 SCALE: 1" = 10' Know what's below. before you dig.Call R LEGEND PROPOSED CONTOUR EXISTING CONTOUR GRADE BREAK PROPOSED SWALE PROPOSED FINISHED GRADE PROPOSED TOP OF CURB/GUTTER PROPOSED TOP OF WALL/ BOTTOM OF WAL PROPOSED TOP OF INLET EXISTING SPOT GRADE EXISTING TOP OF CURB/GUTTER PROPOSED DRAINAGE FLOW ARROW EXISTING DRAINAGE FLOW ARROW PROPERTY BOUNDARY 500 500 FG 700.00 TC 700.50 G 700.00 TW 700.00 BW 699.00 TI 700.00 EX. 700.5± TC 700.5± G 700.0± ZA23-0008 WWWSSSSSS8 10 11 PROP. PATIO 924 SF PROP. BUILDING 2,605 SF PUTTING GREEN ELECPPF P F FHLPLPLPLPLPLPLPLPLPLPLPLPELECELECFHSSSSTELEWMWMWMSDSDELECWMELECEX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX SS EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR EX WTR 30' SETBACK (PER ZONING)30' SETBACK (PER ZONING) 2 5 ' U T I L I T Y E A S E M E N T C A B I N E T A , S L I D E 2 4 2 5 P . R . T . C . T . 1 0 j . EX. 10' CURB INLET EX. 21" STORM PIPE PROP. 10' CURB INLET EX. 10' CURB INLET PROP. 21" STORM PIPE EX. 24" STORM PIPE EX. 27" STORM PIPE EX. 30" STORM PIPE W. SOUTHLAKE BLVD (F.M. HWY NO. 1709) (VARIABLE WIDTH ROW ) 7 FILENAME: PRELIMINARY STORM PLAN_SHP22002.dwgPLOTTED BY: Sydney FosterFULL PATH: K:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site PlanK:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site Plan\PRELIMINARY STORM PLAN_SHP22002PLOTTED DATE: 9/13/2023SITE BENCHMARKS ALL EVELATIONS ARE BASED ON CITY OF SOUTHLAKE BM NO. 33 LOCATED AT LAT. 32°56'30.52072"N, LONG. 97°11"07.20706"W ALUMINUM MONUMENT IN CONCRETE. ELEVATION = 657.38' (NAD '83) KE PROJECT CLIENT LOGO 4809 COLE AVE #330 DALLAS, TX 75205 214-960-4545 SHEET:REV:DATE:DESCRIPTION:SOUTHLAKEMARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXASKIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 TEXAS FIRM NO. 15874 JOB NUMBER: ISSUE DATE: SHP22002 9/13/2023 E N G I N E E R I N G P R E L I M I N A R Y F O R R E V I E W O N L Y T H E S E D O C U M E N T S A R E F O R D E S I G N R E V I E W O N L Y A N D N O T I N T E N D E D F O R T H E PURPOSES OF CONSTRUCTION, B I D D I N G O R P E R M I T . T H E Y W E R E P R E P A R E D B Y , O R UN DE R THE S U P ER VI S IO N OF : P.E.# 91865 SHEA O. KIRKMAN DATE: September 13, 2023 PRELIMINARY STORM PLANGRAPHIC SCALE FEET04020 SCALE: 1" = 20' Know what's below. before you dig.Call R LEGEND EXISTING STORM PIPE PROPOSED STORM PIPE PROPOSED CURB INLET PROPOSED TRENCH DRAIN PROPOSED RETAINING WALL PROPERTY BOUNDARY ZA23-0008 810 11 ELEC S M P P P F P F WVWV SS FH WM CO CO CO COCO ELEC ELEC ELEC CO CO CO CO COCO CO CO COCO CO COCO SS SS SSCO CO ELEC ELEC FH FH FH WV WV WVWV WV FH WV WV WVWV WV WV WV ELEC LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP WV WV WV WM WMWM WM WM GM GM ELEC FH ELEC LP LP ELECELEC FH SS SS COCO CO CO CO ELEC ELEC LP TELE WM WM WM SD SD SD ELEC WM ELEC WM WM WM ELEC ELEC ELEC ELEC ELEC SDSD EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX S S EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R 30' S E T B A C K (PER Z O NI N G) 30' S E T B A C K (PER Z O NI N G) W. SO U T H L A K E B L V D ( F . M . HWY N O . 1 7 0 9 ) (VA R I A B L E W I D T H R O W ) EX. FIRE HYDRANT EX. LIGHT POLE EX. LIGHT POLE EX. LIGHT POLE EX. LIGHT POLE EX. LIGHT POLE EX. LIGHT POLE EX. LIGHT POLE EX. LIGHT POLE EX. LIGHT POLE EX. LIGHT POLE EX. FIRE HYDRANT WSSSTA 0+00.00 LINE "W-1" CONNECT TO EX. WATER METER (CONTRACTOR TO FIELD VERIFY) BEGIN 2" DOM. SERVICE STA 0+95.08 LINE "W-1" END 2" DOM. SERVICE (REFER TO MEP FOR CONTINUATION) STA 0+52.19 ~ SS-1 INSTALL: 1 - GREASE TRAP PER CITY OF SOUTHLAKE STANDARDS FL 6" = 649.98 (NW) FL 6" = 650.18 (SE) STA 0+87.78 ~ SS-1 INSTALL: 1 - INSTALL: 1 - 6" CLEANOUT (REFER TO MEP FOR CONTINUATION) (REFER TO MEP FOR CONTINUATION) FL 6" = 652.00 (NW) EX. LIGHT POLE EX. FIRE HYDRANT EX. FIRE HYDRANT EX. FIRE HYDRANT EX. LIGHT POLE EX. LIGHT POLE EX. LIGHT POLE EX. LIGHT POLE EX. SSMH EX. SSMH EX. SSMH EX. SSMH SS STA 0+00.00 ~ SS-1 INSTALL: 1 - INSTALL: 1 - SSMH SSMH FL 6" = 647.37 (SW) FL 6" = 647.37 (SE) FL 6" = 647.37 (NE) PROP. 6" S.S. @ 5.00% (PRIVATE) EX. LIGHT POLE EX. 6" W A T E R EX. 1 2" W A T E R EX. 6" S E W E R SITE BENCHMARKS ALL EVELATIONS ARE BASED ON CITY OF SOUTHLAKE BM NO. 33 LOCATED AT LAT. 32°56'30.52072"N, LONG. 97°11"07.20706"W ALUMINUM MONUMENT IN CONCRETE. ELEVATION = 657.38' (NAD '83) KE PROJECT CLIENT LOGO 4809 COLE AVE #330 DALLAS, TX 75205 214-960-4545 SHEET:REV:DATE:DESCRIPTION:SOUTHLAKEMARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXASKIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 TEXAS FIRM NO. 15874 JOB NUMBER: ISSUE DATE: SHP22002 9/13/2023 E N G I N E E R I N G P R E L I M I N A R Y F O R R E V I E W O N L Y T H E S E D O C U M E N T S A R E F O R D E S I G N R E V I E W O N L Y A N D N O T I N T E N D E D F O R T H E PURPOSES OF CONSTRUCTION, B I D D I N G O R P E R M I T . T H E Y W E R E P R E P A R E D B Y , O R UN DE R THE S U P ER VI S IO N OF : P.E.# 91865 SHEA O. KIRKMAN DATE: September 13, 2023 8 FILENAME: PUP1.0 PRELIMINARY UTILITY PLAN_SHP22002.dwgPLOTTED BY: Sydney FosterFULL PATH: K:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site PlanK:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site Plan\PUP1.0 PRELIMINARY UTILITY PLAN_SHP22002PLOTTED DATE: 9/13/2023PRELIMINARY UTILITY PLANGRAPHIC SCALE FEET012060 SCALE: 1" = 60' Know what's below. before you dig.Call R LEGEND W W SS SS EX SS EX WTR SS EX UGE EX OHE EX UGE EX GAS EXISTING SANITARY SEWER PROPOSED SANITARY SEWER EXISTING WATER PROPOSED WATER EXISTING SANITARY SEWER MANHOLE PROPOSED SANITARY SEWER MANHOLE PROPOSED SANITARY SEWER CLEANOUT EXISTING FIRE HYDRANT EXISTING GAS EXISTING UNDERGROUND ELECTRIC EXISTING OVERHEAD ELECTRIC EXISTING TELEPHONE PROPERTY BOUNDARY FH ZA23-0008 ELEC S M P P P F P F WVWV SS FH WM CO CO CO COCO ELEC ELEC ELEC CO CO CO CO COCO CO CO COCO CO COCO SS SS SSCO CO ELEC ELEC FH FH FH WV WV WVWV WV FH WV WV WVWV WV WV WV ELEC LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP LP WV WV WV WM WMWM WM WM GM GM ELEC FH ELEC LP LP ELECELEC FH SS SS COCO CO CO CO ELEC ELEC LP TELE WM WM WM SD SD SD ELEC WM ELEC WM WM WM ELEC ELEC ELEC ELEC ELEC SDSD EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R EX W T R PLAYERS CIRCLE ADDITION CABINET A, SLIDE 10975 P.R.T.C.T. 250 PLAYER CIRCLE LLC, ZONING C-3 L.U.D. = RETAIL COMMERCIAL LOT 5, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 6, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 8, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) SL MARKETPLACE PARTNERS LP, ZONING C-3 L.U.D. = RETAIL COMMERCIAL TRACT 3 LOT 2R, BLOCK 1, SOUTHLAKE CROSSING PHASE I (CABINET A, SLIDE 1613, P.R.T.C.T.) TRACT 3 LOT 2R, BLOCK 1, SOUTHLAKE CROSSING PHASE I (CABINET A, SLIDE 1613, P.R.T.C.T.) STORE MASTER FUNDING XIV LLC, ZONING SP1 L.U.D. = RETAIL COMMERCIAL LOT 7, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) 30' S E T B A C K (PER Z O NI N G) 30' S E T B A C K (PER Z O NI N G) N51° 2 6' 3 4" E 565. 0 0'N3 8 ° 3 3 ' 2 6 "W 2 2 0 . 0 0 ' S51° 2 6' 3 4" W 80.0 0'N3 8 ° 3 3 ' 2 6 "W 1 9 6 . 7 4 ' N51° 2 5' 3 5" E 114. 3 3'S3 8 ° 3 4 ' 1 9 "E 1 5 9 . 5 8 ' N51° 2 5' 4 1" E 226. 9 2'S3°37'47"E1044.45'N89°50'53"W 317.33' S51° 2 6' 3 4" W 65.8 5'N3 8 ° 3 3 ' 2 6 "W 1 9 0 . 0 0 ' S51° 2 6' 3 5" W 20.0 0'N3 8 ° 3 3 ' 2 6 "W 2 0 5 . 0 0 ' W. SO U T H L A K E B L V D (F.M . H W Y N O . 1 7 0 9 ) (VA R I A B L E W I D T H R O W ) LOT 4, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 1614, P.R.T.C.T.) SLM DUNHILL LLC, ZONING C-3 L.U.D. = RETAIL COMMERCIAL PROP. OPEN SPACE PROP. PATIO PROP. PATIO EX. BUILDING ZONING C-3 71,301 SF EX. BUILDING ZONING C-3 15,561 SF EX. BUILDING ZONING C-3 20,236 SF EX. BUILDING ZONING C-3 5,000 SF #1 #2 #3 #4 #5 #6 #7 #9 #8 #10 #14 #12 #11 #13 #15 #16 #17 #18 #19 #20 #21 #22 #23 #24 #25 #26 #27 #28 #29 #30 #31 #32 #33 #34 #35 #36 #37 #38 #39 #40 #41 #42 #43 #44 #45 #46 #47 #49 #48 #50 #51 #52 #53 #54 #55 #56 #57 #58 #59 #60 #61 #62 #63 #64 #65 #66 #67 #68 #69 #70 #71 #72 #73 #74 #75 #76#77#78 #79 #80 #84 #85 #86 #87 #88 #81 #82 #83 #89 #90 #91 #92 #93 #97 #94 #95 #96 #99 #98 #100 #101 #102 #103 #104 #105 #106 #107 #108 #109 #110 #111 #112 #113 #114 #115 #116 #117 #118 #119 #120 #121 #122 #123 #124 #125#126 #127 #128 #129 #130 #131 #136 #135 #134 #133 #132 #137 #138 #139 #140 #141 #142 #143 #144 #145 #146 #147 #148 #149 #150 #151 #152 #153 #155 #154 #156 #157 #158 #159 #160 #163 #161 #162 #164#165 #168 #169 #166#167 #170 #172 #171 #173 #174 #175 #176 #178 #177 #179 #180#181 #182 #183 #184 #185 #186 #187 #188 #189 #190 #191 #192 #193 #194 #195 #196 #197 #198 #199 #200 #201 #202 #204 #205 #203 #206 #207 #208 #209 #210 #211 #212 #213 #214 #215 #216 #217 #218 #219 #220 #221 #222 #223 #224 #225 #226 #227 #228 #229 #230 #231#232 #235 #233 #234 #238 #237 #236 #239 #241 #240 #243 #242 LEGEND 9 FILENAME: TREE CONSERVATION PLAN.dwgPLOTTED BY: Sydney FosterFULL PATH: K:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site PlanK:\Jobs\shp22002_southlake Marketplace\Drawings\zoning & Site Plan\TREE CONSERVATION PLANPLOTTED DATE: 9/13/2023EXISTING TREE COVER CALCULATIONS PERCENTAGE OF EXISTING TREE COVER ON THE ENTIRE SITE 0.41% MINIMUM PERCENTAGE OF EXISTING TREE COVER TO BE PRESERVED 70% PERCENTAGE OF EXISTING TREE COVER TO BE REMOVED 10.53% PERCENTAGE OF EXISTING TREE COVER TO BE PRESERVED 89.47% TREE CONSERVATION PLANGRAPHIC SCALE FEET012060 SCALE: 1" = 60' PROTECTED TREE TO REMAIN PROTECTED TREE TO BE REMOVED PROPERTY BOUNDARY KE PROJECT CLIENT LOGO 4809 COLE AVE #330 DALLAS, TX 75205 214-960-4545 SHEET:REV:DATE:DESCRIPTION:SOUTHLAKEMARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXASKIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 TEXAS FIRM NO. 15874 JOB NUMBER: ISSUE DATE: SHP22002 9/13/2023 E N G I N E E R I N G P R E L I M I N A R Y F O R R E V I E W O N L Y T H E S E D O C U M E N T S A R E F O R D E S I G N R E V I E W O N L Y A N D N O T I N T E N D E D F O R T H E PURPOSES OF CONSTRUCTION, B I D D I N G O R P E R M I T . T H E Y W E R E P R E P A R E D B Y , O R UN DE R THE S U P ER VI S IO N OF : P.E.# 91865 SHEA O. KIRKMAN DATE: September 13, 2023 ZA23-0008 SPIN MEETING REPORT SPIN Item Number: SPIN2023-01 City Case Number: N/A Project Name: Southlake Marketplace SPIN Neighborhood: 10 Meeting Date: January 10, 2023 Meeting Location: 1400 Main Street, Southlake, TX City Council Chambers Total Attendance: 3 Hosts: Madeline Oujesky Applicant Presenting: Buck Wheeler, Phone: (214) 960-2818, Email: buck@shopcompanies.com City Staff Present: Madeline Oujesky, Assistant to the Director Town Hall Forums can be viewed in their entirety by visiting http://www.cityofsouthlake.com and clicking on “I Want to” and “View” “Video on Demand” – forums are listed under SPIN by meeting date. FORUM SUMMARY: Property Situation: 2603 W. Southlake Blvd. Development Details: • Acquired Southlake Marketplace in April of 2022 with the initiative to redevelop it in a sensitive manner. When originally developed, 25% of the property was required to be green space. There is dead space on the south end of the project combined with green space. We look at this as wasted space. From a pedestrian scale we think there is a lot to be improved on. • Since acquiring the property in April of 2022, we have repainted the shopping center and have signed several new leases. o A vet clinic, an acai bowl and currently working with ATA Martial Arts to relocate within the center. Exciting restaurant concepts interested in leasing space. • Want to increase the time that the public and consumers interact with the property and stay on property. This would help with retail sales which ultimately drives sales tax revenue and ad valorem tax revenue. • Parking and landscape improvements we are proposing. o Head in parking instead of angled parking. o Have trees in the parking lot and oversize landscaping islands and improve the overall feel of the shopping center pedestrian experience. o Have patio areas where there is parking and a fire lane. Drive additional revenue through patio areas as well as activate the shopping center and make it feel much more vibrant. • The area between Starbucks and the Baskin Robbins building would be a freestanding single tenant building with a drive through. o Currently working with a user that is not in the DFW market currently. Has a signed confidentiality with this tenant so unable to share whom the tenant is. Outdoor family-oriented space who believe this is a great location for them. • Income would be able to pay for all these common air improvements and increase the pedestrian experience. Create oversize walkway to increase the desire for pedestrians to walk from storefront to storefront. Have patios facing into each other and have a flex space for kids. • All proposed planned improvements benefit the neighborhood and the center itself. o From a social standpoint, it would add approximately 3500 square feet of outdoor patio seating. o From an environmental standpoint, we would be significantly reducing the heat island and reducing the overall temperature of what the parking lot feels like by softening it with landscape and trees. The addition of the parking lot islands would add approximately 33 net trees which reduces the carbon footprint. o From an economic standpoint we are drawing more tenants and partnering with existing tenants to ensure they are successful in driving revenue and business. Presentation: Questions and Concerns: N/A SPIN Meeting Reports are general observations of SPIN Meetings by City staff and SPIN Representatives. The report is neither verbatim nor official meeting minutes; rather it serves to inform elected and appointed officials, City staff, and the public of the issues and questions raised by residents and the general responses made. Responses as summarized in this report should not be taken as guarantees by the applicant. Interested parties are strongly encouraged to follow the case through the Planning and Zoning Commission and final action by City Council. Southlake Connect Results for the January 10, 2023 SPIN Town Hall Forum Southlake 2035 Corridor Planning Committee Meeting Report Meeting 36 – February 7, 2022 MEETING LOCATION: 1400 Main St., Southlake, Texas 76092 City Council Chambers IN ATTENDANCE: • City Council Members: Randy Robbins, Kathy Talley, Amy Torres-Lepp • Planning & Zoning Commission Members: Daniel Kubiak, Gina Phalen, Michael Springer • Park Board Member: Frances Scharli • Ex-Officio Member: Shawn McCaskill • City Staff: Ken Baker, Dennis Killough, Patty Moos, Madeline Oujesky AGENDA ITEMS: 1. Call to Order. 2. Administrative Comments. 3. Review, discuss and make recommendations on the development of approximately 5 acres of land for retail, restaurant and office development located at 2300 E. SH 114, 411 N. Kimball Ave. and 328 Shady Ln., generally located on the north side of E. SH 114, between N. Kimball Ave. and Shady Ln. 4. Review, discuss and make recommendations on the development of approximately 5 acres for Dragon Auto Spa car wash located at 2300 E. SH 114, 411 N. Kimball Ave. and 328 Shady Ln., generally located on the north side of E. SH 114, between N. Kimball Ave. and Shady Ln. 5. Review, discuss and make recommendations on a proposed 9 lot single family residential development on approximately 5.4 acres located at 101 Highland Street. 6. Review, discuss and make recommendations on a proposed mixed use development including office uses and 13 single family residential lots located at 8850 Davis Boulevard. 7. Review, discuss and make recommendations on a proposed 4 lot single family residential development on approximately 4.5 acres located at 4078 N. White Chapel Blvd. 8. Review, discuss and make recommendations for proposed changes to the Southlake Marketplace (aka Southlake Crossing) retail center located at 2225, 2155, 2101, 2055, and 2001 W. Southlake Blvd. The proposal excludes 2201 W. Southlake Blvd. (Urban Air), 2255 W. Southlake Blvd. (Dunkin Donuts), and 125 Davis Blvd. (Texas Health Breeze Urgent Care) which are also within the Southlake Marketplace shopping center. 9. Review, discuss and make recommendations for the proposed development of a restaurant, retail and a brewery / taproom with outdoor amenities on approximately 5.92 acres located at 200 Davis Blvd. 10. Review, discuss and make recommendations for the proposed development of Green Acres Nursery & Supply on approximately 14.2 acres located at 1963 W. Southlake Blvd. 11. Review, discuss and make recommendations for the proposed development of The Vet Gal and Guys vet clinic on approximately 0.9 acres located at 1481 E Continental Blvd. (1400 E. E. Continental Blvd. per TAD). 12. Adjournment. MEETING OVERVIEW: On February 7, 2022 the Southlake 2035 Corridor Planning Committee held their thirty-sixth meeting. The Committee was sent a packet of materials prior to the meeting that were to be discussed during the session. A meeting agenda was posted, and the meeting time was advertised on the City’s website. The following meeting report focuses on discussion points made during the meeting by members of the Committee, public and City staff. This report is neither verbatim nor does it represent official meeting minutes; rather it serves to inform elected and appointed officials, City staff, and the public of the issues and questions raised by the Committee, City staff, and any attendees of the meeting . Interested parties are strongly encouraged to follow development cases through the process. Please visit CityofSouthlake.com/Planning for more information. Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 3 ITEM #8 DISCUSSION – Review, discuss and make recommendations for proposed changes to the Southlake Marketplace (aka Southlake Crossing) retail center located at 2225, 2155, 2101, 2055, and 2001 W. Southlake Blvd. The proposal excludes 2201 W. Southlake Blvd. (Urban Air), 2255 W. Southlake Blvd. (Dunkin Donuts), and 125 Davis Blvd. (Texas Health Breeze Urgent Care) which are also within the Southlake Marketplace shopping center. Staff presentation: Ken Baker • The proposal is within the areas outline in blue (16.1 acres). The proposal excludes 2201 W. Southlake Blvd. (Urban Air), 2255 W. Southlake Blvd. (Dunkin Donuts), and 125 Davis Blvd. (Texas Health Breeze Urgent Care) which are also within the Southlake Marketplace shopping center. • Future Land Use – Retail Commercial • Zoning – C3 • The applicant’s submission materials outline the proposed changes to the shopping center. The applicant indicates that Southlake Market place has several challenges including vehicular access, poor wayfinding, lack of trees in the parking areas, lack of outdoor social spaces, dated storefronts, poor street presence, minimal landscaping and not pedestrian friendly. • Proposed improvements to the shopping area and include: o 1) intersection improvements (pages 9-10) o 2) improved entry and arrival experience (pages 11 -13 o 3) expanded open spaces/ 2 new retail building (pages 14 - 16) o 4) outdoor patio areas (pages 17-24) o 5) parking lot enhancements (pages 25-27). • Part of the submission proposes improvements to the drive entry off FM 1709: o In 2013 the City of Southlake, the previous owner of the shopping center and TXDOT began discussions on possible new drive access points to the Southlake Market Place Development in conjunction with the FM 1938 widening project. During this time, preliminary design 6 concepts were developed which included driveway closures, building a new driveway, and converting an emergency signal to a full signal near the drive location. Also, the preliminary design included modifications to the intersection at Fire Department Station #2, which allowed emergency vehicles to access FM 1709 from the station without delay. Also, the project required the relocation of an Atmos gas regulator and line along FM 1709. • A possible partnership/funding participation between TXDOT, the City and the previous owner of the shopping center was considered for the project (public investment). Funds were allocated in the City’s Capital Improvements Program (CIP) for construction in FY 2017. However, a funding agreement with the shopping center owner at the time was not executed and the project did not move forward. Subsequently, funding for the project was removed from the CIP. Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 4 Questions for staff by the Committee: N/A Applicant presentation: Questions for applicant by the Committee: Shawn McCaskill: This is a long time coming, I'm excited to see this. Especially the entrance and parking lot. Having these parking islands is a huge step forward. Michael Springer: So, nothing will happen to Urban Air’s parking? Ken Baker: No, it will not. They do not control that area. When Urban Air came through you might remember we did some parking lot enhancements with planting islands. Urban Air is not a part of this. Michael Springer: Strange that you could have some areas that match and others that have non-matching aesthetics. Kathy Talley: Great because its needs an uplift. It would be nice to have this space here. Frances Scharli: Be mindful of where the park is placed in conjunction with Starbucks. Make sure it is safe. Applicant: We do not control Urban Air, but we have a relationship with the owner and would work with us to make the wholesale change we are making. We will look at the park closely and address any safety concerns. Excited about this property because it is a gateway to Southlake. We will continue to develop other ideas, but we would like to make it exciting and great. Kathy Talley: You must be careful by that Starbucks, it can be dangerous. Daniel Kubiak: Is the Starbucks parcel a part of this? Applicant: Yes. Daniel Kubiak: This is new ownership? Applicant: Yes. Amy Torres-Lepp: I love the walkability idea. I saw a great park feature on the renderings which would be a great way to get people to the space. I’m very excited for this. Frances Scharli: I agree, this is such an improvement, it’s unbelievable. Applicant: We are excited to move forward with this. Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 5 STAFF PRESENTATION SHOWN TO COMMITTEE: Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 6 Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 7 Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 8 Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 9 Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 10 Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 11 Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 12 Southlake Corridor Planning Committee Item #8 – Southlake Marketplace Meeting #35 – February 7, 2022 Page 13 Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 2 Table of Contents Table of Contents .................................................................................................................................... 2 List of Tables ........................................................................................................................................... 3 List of Figures .......................................................................................................................................... 4 List of Exhibits ......................................................................................................................................... 5 Executive Summary ................................................................................................................................. 6 Introduction ............................................................................................................................................ 9 Site Accessibility and Study Impact Area ................................................................................................ 13 Traffic Volumes ..................................................................................................................................... 17 Trip Generation ..................................................................................................................................... 21 Trip Distribution and Assignment........................................................................................................... 23 Access Point Analyses ............................................................................................................................ 30 Intersection Capacity Analysis ............................................................................................................... 32 Queue Length Analysis .......................................................................................................................... 37 Conclusions ........................................................................................................................................... 40 Recommendations ................................................................................................................................ 43 Appendix A – Site Plan ........................................................................................................................... 44 Appendix B – Scoping Email ................................................................................................................... 46 Appendix C – Turning Movement Count Data ........................................................................................ 51 Appendix D – Distribution Tables & Calculations for Background 2024 & Buildout 2024 Traffic Conditions ................................................................................................................................................. 67 Appendix E – Existing Traffic Signal Timing Plans .................................................................................... 74 Appendix F – Synchro Outputs ............................................................................................................... 92 Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 3 List of Tables Table 1. Historical TxDOT Annual Average Daily Traffic Volumes (Vehicles per Day). ............................. 19 Table 2. Trip Generation Characteristics for Proposed Development. .................................................... 22 Table 3. Right-Turn Deceleration Lane Analysis for Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2).............................................................................................................................. 30 Table 4. Right-Turn Deceleration Lane Analysis for Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3).............................................................................................................................. 31 Table 5. Control Delay Based Level of Service (LOS) Criteria for Signalized and Unsignalized Intersections. ..................................................................................................................................................... 33 Table 6. Intersection Capacity Analysis Scenarios and Associated Exhibits. ............................................ 33 Table 7. Intersection Capacity Analysis Results for FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1). ..................................................................................................................... 34 Table 8. Intersection Capacity Analysis Results for Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2).............................................................................................................................. 35 Table 9. Intersection Capacity Analysis Results for Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3).............................................................................................................................. 36 Table 10. Variables for Estimating Queue Lengths................................................................................. 38 Table 11. Storage Capacities for Proposed Development. ..................................................................... 39 Table 12. Queue Length Probabilities for the Proposed Development. .................................................. 39 Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 4 List of Figures Figure 1. Impact Area and Existing Land Use. ........................................................................................ 11 Figure 2. Site Plan (Site Layout). ............................................................................................................ 12 Figure 3. Available Queuing Space for Proposed Site Plan. .................................................................... 37 Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 5 List of Exhibits Exhibit 1. Existing 2023 & Background 2024 Lane Configuration. .......................................................... 14 Exhibit 2. Buildout 2024 Lane Configuration. ........................................................................................ 16 Exhibit 3. Existing 2023 Traffic Volumes (AM & PM Collected on Thursday, February 16, 2023) ............ 18 Exhibit 4. Background 2024 Traffic Condition. ....................................................................................... 20 Exhibit 5. Distribution Percentages for Primary Trips. ........................................................................... 24 Exhibit 6. Distribution Percentages for Pass-by Trips. ............................................................................ 25 Exhibit 7. Primary Trips Associated with Proposed Development. ......................................................... 26 Exhibit 8. Pass-by / Diverted Trips Associated with Proposed Development. ......................................... 27 Exhibit 9. Total Site Trips (Pass-by & Primary). ...................................................................................... 28 Exhibit 10. Buildout 2024 Traffic Condition. .......................................................................................... 29 Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 6 Executive Summary This study analyzes the potential traffic impacts of the proposed development: Birdcall Restaurant. The location of the proposed development is east of FM 1938 (Randol Mill Ave) and south of FM 1709 (Southlake Blvd) in Southlake, TX. It will be an out parcel in an existing commercial development. The impact area of the proposed development includes following existing study intersections: • FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1). • Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2). • Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3). The proposed land use(s) include: • Up to 2,400 square feet gross floor area of Fast-Food Restaurant with Drive-Through Window (ITE Land Use Code 934). The Restaurant will also have a 2,500 square foot patio area. Note: Most Birdcall Restaurants do not serve breakfast. However, this could change in the future, therefore, this report includes an AM Peak Hour analysis. The proposed development does not add any new access points. This study evaluates the following existing access points: • Access Point 1 (AP1): An existing right-in/right-out access along FM 1709 approximately 550 feet east of FM 1938. • Access Point 2 (AP 2): An existing right-in/right-out access along FM 1938 approximately 300 feet south of FM 1709. This study discusses (but does not evaluate) the following existing access points that are part of the larger commercial development. • Access Point A (AP A): An existing right-in/right-out/left-in access along FM 1709 approximately 1,050 feet east of FM 1938. • Access Point B (AP B): An existing right-in/right-out access along FM 1709 approximately 300 feet east of FM 1938. • Access Point C (AP C): An existing right-in/right-out access along FM 1938 approximately 130 feet south of FM 1709. This study estimates the total number of trips entering and exiting the proposed development will be (includes both pass-by and primary trips): • 7,272 Daily Trips. • 108 AM Peak Hour Trips. • 124 Midday Peak Hour Trips. • 80 PM Peak Hour Trips. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 7 Intersection Capacity Analysis Existing 2023 Traffic Condition FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1) falls within the range for Intersection Level of Service F in the AM Peak Hour and E in the Midday and PM Peak Hour. Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) falls within the range for LOS F in the AM Peak Hour with a Volume to Capacity Ratio (V/C) of 0.76. Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3) falls within the range for Level of Service C or better in the evaluated scenarios. Background 2024 Traffic Condition FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1) falls within the range for Intersection Level of Service F in the AM Peak Hour and E in the Midday and PM Peak Hour. Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) falls within the range for LOS F in the AM Peak Hour with a Volume to Capacity Ratio (V/C) of 0.81. Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3) falls within the range for Level of Service C or better in the evaluated scenarios. Buildout 2024 Traffic Condition FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1) falls within the range for Intersection Level of Service F in the AM Peak Hour and E in the Midday and PM Peak Hour. Given level of service and delay are similar in the Background and Buildout traffic conditions, this study does not propose any mitigations at Intersection 1. Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) falls within the range for LOS F in the AM Peak Hour with a Volume to Capacity Ratio (V/C) of 0.97. This is a worst-case scenario. It is likely reasonable and prudent drivers will redistribute to alternative exits to obtain a more reasonable delay and volume to capacity ratio. Therefore, this study does not propose any mitigations at Intersection 2. Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3) falls within the range for Level of Service C or better in the evaluated scenarios. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 8 Access Management Analysis Access 1 (Intersection 2) Volumes for Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) fall below the TxDOT threshold (60 vph) for considering a right-turn deceleration lane. Access 2 (Intersection 3) Volumes for Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3) fall below the TxDOT threshold (60 vph) for considering a right-turn deceleration lane. Queue Length Analysis The queue length analysis suggests the probability of a queue extending onto Southlake Blvd during the Midday (Lunch) Peak is 16%. And the probability during the PM (Dinner) Peak is 12%. This study presumes Birdcall will adjust their service rate as demand increases. Additionally, there is an option for Birdcall to take steps to have the queue extend further into the development than what is shown in Figure 3. Based upon these results, the proposed site plan has sufficient queueing are for the anticipated demand. Recommendations Buildout 2024 This study does not propose any mitigations. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 9 Introduction This study analyzes the potential traffic impacts of the proposed development: Birdcall Restaurant. The location of the proposed development is east of FM 1938 (Randol Mill Ave) and south of FM 1709 (Southlake Blvd) in Southlake, TX. It will be an out parcel in an existing commercial development. Figure 1 is a map of the impact area and shows existing land uses. Figure 2 is an image of the proposed site layout; Appendix A contains a larger version. The proposed land use(s) include: • Up to 2,400 square feet gross floor area of Fast-Food Restaurant with Drive-Through Window (ITE Land Use Code 934). The Restaurant will also have a 2,500 square foot patio area. Note: Most Birdcall Restaurants do not serve breakfast. However, this could change in the future, therefore, this report includes an AM Peak Hour analysis. The proposed development does not add any new access points. This study evaluates the following existing access points: • Access Point 1 (AP1): An existing right-in/right-out access along FM 1709 approximately 550 feet east of FM 1938. • Access Point 2 (AP 2): An existing right-in/right-out access along FM 1938 approximately 300 feet south of FM 1709. This study discusses (but does not evaluate) the following existing access points that are part of the larger commercial development. • Access Point A (AP A): An existing right-in/right-out/left-in access along FM 1709 approximately 1,050 feet east of FM 1938. • Access Point B (AP B): An existing right-in/right-out access along FM 1709 approximately 300 feet east of FM 1938. • Access Point C (AP C): An existing right-in/right-out access along FM 1938 approximately 130 feet south of FM 1709. Study Scope Appendix B contains an email exchange between Lee Engineering and City of Southlake staff confirming the scope for this study. Study Elements This study includes the following elements: Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 10 Data Collection • A subcontractor collected Vehicle volumes in February 2023 and March 2023. • Obtained the proposed site plan, information on planned roadway improvements, information on other developments in the area, and other relevant information. • Performed a field visit to observe existing operation and to confirm existing lane configurations. Traffic Analysis • Assessed the general accessibility of the site. • Estimated the number of trips the proposed development will generate. • Estimated the directional distribution of traffic approaching/departing the development. • Assigned the estimated site traffic to the street network. • Analyzed the impact of the proposed development on impact area roadways. Documentation • Prepared this report documenting the study procedures and results. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 11 Figure 1. Impact Area and Existing Land Use. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 12 Figure 2. Site Plan (Site Layout). Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 13 Site Accessibility and Study Impact Area Site accessibility describes how people (vehicles) get to and from a development. Geographical location with respect to other activity areas, the roadway system, and other physical constraints affect a Site’s Accessibility. The proposed development does not add any new access points. This study evaluates the following existing access points: • Access Point 1 (AP1): An existing right-in/right-out access along FM 1709 approximately 550 feet east of FM 1938. • Access Point 2 (AP 2): An existing right-in/right-out access along FM 1938 approximately 300 feet south of FM 1709. This study discusses (but does not evaluate) the following existing access points that are part of the larger commercial development. • Access Point A (AP A): An existing right-in/right-out/left-in access along FM 1709 approximately 1,050 feet east of FM 1938. • Access Point B (AP B): An existing right-in/right-out access along FM 1709 approximately 300 feet east of FM 1938. • Access Point C (AP C): An existing right-in/right-out access along FM 1938 approximately 130 feet south of FM 1709. Impact Area The impact area of the proposed development includes following existing study intersections: • FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1). • Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2). • Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3). Figure 1 provides an image of the impact/study area. Existing 2023 Lane Configuration Exhibit 1 shows the existing lane configuration at study intersections. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 15 Impact Area Roadways Existing roadways within the impact area include: • FM 1709 (Southlake Blvd). • FM 1938 (Randol Mill Ave). The following text describes the existing roadways and any assumptions associated with these existing roadways that influence analyses and recommendations within this report. FM 1709 (Southlake Blvd) Near FM 1938 (Randol mill Ave), FM 1709 is a 6-lane divided roadway and a speed limit of 45 mph. The City of Southlake Throughfare plan classifies it as a 130’ to 140’ 6-Lane Divided Arterial. The TxDOT statewide planning map classifies it as a Principal Arterial. The TxDOT Online Project Tracker does not identify any major capacity improvements for this roadway within the next 10 years. At its intersection with FM 1938 (Intersection 1) there is a traffic signal. FM 1938 (Randol Mill Ave) Near FM 1709 (Southlake Blvd), FM 1938 (Randol Mill Ave) is a 6-lane divided roadway and a speed limit of 45 mph. The City of Southlake Throughfare plan classifies it as a 130’ to 140’ 6-Lane Divided Arterial in the City of Southlake Throughfare Plan. The TxDOT statewide planning map classifies it as a Principal Arterial. The TxDOT Online Project Tracker does not identify any major capacity improvements for this roadway within the next 10 years. At its intersection with FM 1709 (Intersection) there is a traffic signal. Background 2024 Lane Configuration (Buildout Year) Exhibit 1 shows the Background 2024 lane configuration. It is the same as the Existing 2023 Lane Configuration. Buildout 2024 Exhibit 2 shows the Buildout 2024 lane configuration. Based upon analyses within this study, it is the same as the Existing 2023 and Background 2024 Lane Configuration. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 17 Traffic Volumes Appendix C contains the turning movement count data collected for this study. Existing Traffic Volumes A subcontractor collected Vehicle turning movement count data at the following locations: • FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1). • Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2). • Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3). On Thursday February 16, 2023, a subcontractor collected vehicle turning movement counts during the following times: • Weekday AM Peak Period (6:30 AM to 8:30 PM). • Weekday PM Peak Period (4:30 PM to 6:30 PM). On March 23, 2023, a subcontractor collected vehicle turning movement counts during the following times: • Weekday Midday (MID) Peak Period (11:30 AM to 1:30 PM). Exhibit 3 shows the peak 1-hour volume for each intersection extracted from the turning movement count data. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 19 Growth Rate To be conservative, this study uses a growth rate of 2.0% to grow existing traffic volumes to the Background 2024 year. The growth rate is based upon the historical annual average daily traffic volumes shown in Table 1. These volumes are from TxDOT’s Statewide Planning Map. Table 1. Historical TxDOT Annual Average Daily Traffic Volumes (Vehicles per Day). Background 2024 Traffic Condition (Buildout Year) Exhibit 4 contains the Background 2024 Traffic Condition. This is the growth of the existing volumes (shown in Exhibit 3) to the Buildout year. 220H26 220H23 Year AADT Growth Percent Year AADT Growth Percent 2021 39,112 19.9%2021 22,976 3.6% 2020 32,609 -20.9%2020 22,176 -18.0% 2019 41,219 -3.6%2019 27,044 -1.9% 2018 42,739 1.9%2018 27,561 2.7% 2017 41,950 -0.7%2017 26,830 8.5% 2016 42,263 -5.1%2016 24,720 -9.1% 2015 44,539 9.9%2015 27,190 4.0% 2014 40,524 -2.9%2014 26,147 -7.3% 2013 41,722 -0.7%2013 28,192 8.4% 2012 42,000 10.5%2012 26,000 8.3% 2011 38,000 0.0%2011 24,000 -4.0% 2010 38,000 --2010 25,000 -- -1.5%-1.5% 0.3%-0.4% Station Flag:Station Flag: FM 1938 south of FM 1709FM 1709 east of FM 1938 10-Year Rate:10-Year Rate: 5-Year Rate:5-Year Rate: Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 21 Trip Generation Proposed Development The proposed land use(s) include: • Up to 2,400 square feet gross floor area of Fast-Food Restaurant with Drive-Through Window (ITE Land Use Code 934). The Restaurant will also have a 2,500 square foot patio area. This study estimates the number of vehicle trips generated by the proposed development using the trip generation rates or equations provided within the Institute of Transportation Engineers (ITE) Trip Generation Manual, 11th Edition. The number of trips generated by the development is a function of the type and quantity of the land use characteristics within the proposed development. Table 2 shows the trip generation rate or equation, the directional split, and the estimated number of trips for the: • Average Weekday. • AM Peak Hour of the Adjacent Street. • Midday (MID) Peak Hour – The rate used is the PM Peak Hour of the Generator. • PM Peak Hour of the Adjacent Street. Note: Most Birdcall Restaurants do not serve breakfast. However, this could change in the future, therefore, this report includes an AM Peak Hour analysis. Pass-by/Diverted Trips A Pass-by or Diverted Trip is when a motorist makes an intermediate stop at an adjacent land use during their journey to their primary trip destination. Pass-by and Diverted Trips are attracted out of the existing traffic streams adjacent to the site; they are not new traffic generated by the development. The ITE Trip Generation Handbook publishes average pass-by rates for different land uses based on studies at similar types of developments. This study considers the impact of pass-by trips for the Fast-Food Restaurant with Drive-Through Window land use. For a Fast-Food Restaurant with Drive-Through Window, ITE indicates a pass-by percentage of 50% for the AM Peak hour and 55% for the PM Peak hour. ITE does not provide a pass-by information for the Midday Peak Hour. Therefore, this study applies the AM Peak Hour Pass-by Rate of 50% to the Midday Peak Hour. Based upon this information, this study estimates the proposed development will attract: • 54 AM Peak Hour Pass-by Trips. • 62 Midday Peak Hour Pass-by Trips. • 44 PM Peak Hour Pass-by Trips. These are vehicles already traveling along the roadways adjacent to the proposed development. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 22 Primary Trips Primary trips are new trips added to the roadway network by the proposed development. This study estimates the proposed development will generate: • 54 AM Peak Hour Primary Trips. • 62 Midday Peak Hour Primary Trips. • 36 PM Peak Hour Primary Trips. Total Trips This study estimates the total number of trips entering and exiting the proposed development will be (includes both pass-by and primary trips): • 7,272 Daily Trips. • 108 AM Peak Hour Trips. • 124 Midday Peak Hour Trips. • 80 PM Peak Hour Trips. Table 2. Trip Generation Characteristics for Proposed Development. Description ITE Code Fast-Food Restaurant with Drive-Through Window 934 Description ITE Code Fast-Food Restaurant with Drive-Through Window 934 In Out In Out In Out In Out 2.400 1000 Sq. Ft. GFA (For Equations: T = Trips, X = Independent Variable) Total In Out In 80 31 31 27 27 31 31 Fast-Food Restaurant with Drive-Through Window ------ MID Peak Hour Total In Out AM Peak Hour MID Peak Hour 108 OutTotal Weekday ------54 Weekday Total ---- MID Peak Hour Total Primary Trips: (New Trips added to Roadway Network) Total In Out Fast-Food Restaurant with Drive-Through Window 1,122 ------ 561 561 Land Use Independent Variable AM Peak Hour Total In Out 51%49%50%50% Weekday 51% Rates PM Peak Hour 33.03 Directional Split PM Peak Hour MID Peak Hour 50.94 AM Peak Hour 44.61 AM Peak Hour 467.48 Weekday 52%48% 62 Number of Trips PM Peak Hour Total In Out 49% 53 124 63 61 62 32 30 Total 27 62 36 19 17 PM Peak Hour In Out 36 19 17 44 23 21 Total Trips (Pass-By & Primary):1,122 561 561 108 55 26 62 32 30 44 23 54 27 Total Pass-By Trips:--21 Fast-Food Restaurant with Drive-Through Window 42 38 53 124 63 61 80 42 38 54 28 Pass-By vs. Primary Trips In Out 54 28 26 55 Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 23 Trip Distribution and Assignment Appendix D contains trip distribution tables associated with the Background 2024 and Buildout 2024 traffic conditions. Trip Distribution Exhibit 5 shows the anticipated distribution percentages for primary trips. Exhibit 6 shows the anticipated distribution percentages for pass-by and diverted trips. The directional distributions are based upon the collected turning movement volumes at the study intersection(s), existing developments in the surrounding area, roadway configurations in the surrounding area, and the proposed site plan. Total Site Trips Exhibit 7 shows the primary site trips added to the roadway network at study intersections. Exhibit 8 shows the pass-by and diverted site trips added to the roadway network at study intersections. Exhibit 9 shows total site trips (primary, pass-by, and diverted) added to the roadway network at study intersections. Note: The estimated number of trips shown in Table 2 may not exactly match the values shown in the Exhibits. Additionally, there could be minor variations in volumes between intersections. These differences are a result of rounding partial trips up to the nearest whole trip within the trip distribution tables in Appendix D and Appendix D. Buildout 2024 Traffic Condition Exhibit 10 contains the Buildout 2024 Traffic Condition. Buildout 2024 traffic condition volumes are the following exhibits added together: • Background 2024 Traffic Condition, Exhibit 4. • Site Traffic Assigned to Roadway Network. Exhibit 9. SUITE 1660 972-248-3006 TBPE FIRM F-450 3030 LBJ FREEWAY DALLAS, TEXAS 75234 Exhibit 6 NOT TO SCALEN Distribution Percentages for Pass-By TripsNorthSouthEast West NorthSouthEast West Int. #2 East West North South North South West East Int. #1 Int. #3 SITE AP 2 AP C AP B AP 1 AP A Development Full (Southlake Blvd) FM 1709 Int. A (Southlake Blvd)FM 1709 Players CirMea do wlark L n LEGEND NOT SIGNALIZED (STUDY INTERSECTION) SIGNALIZED (NOT STUDY INTERSECTION) SIGNALIZED (STUDY INTERSECTION)+20%+30%-30% -30% -30%(+30%)-20%+20%(+20%)+50%-30% (+30 %)-20%(+70%) AM [MID] (PM) ENTERING % AM [MID] (PM) EXITING %(Randol Mill Ave)FM 1938(Randol Mill Ave)FM 1938 SUITE 1660 972-248-3006 TBPE FIRM F-450 3030 LBJ FREEWAY DALLAS, TEXAS 75234 Exhibit 8 NOT TO SCALENNorthSouthEast West NorthSouthEast West Int. #2 East West North South North South West East Int. #1 Int. #3 SITE AP 2 AP C AP B AP 1 AP A Development Full (Southlake Blvd) FM 1709 Int. A (Southlake Blvd)FM 1709 Players CirMea do wlark L n LEGEND NOT SIGNALIZED (STUDY INTERSECTION) SIGNALIZED (NOT STUDY INTERSECTION) SIGNALIZED (STUDY INTERSECTION) Pass-By / Diverted Trips Associated with Proposed Development+6 [+6] (+5)+8 [+9] (+7)-9 [-10] (-7)-6 [-7] (-5)+6 [+7] (+5)-9 [-10] (-7) 14 [16] (12) +8 [+9] (+7) -9 [-10] (-7)-9 [-10] (-7) +9 [+10] (+7) 19 [21] (15)-6 [-7] (-5)6 [7] (5)AM [MID] (PM) PEAK HOUR ENTERING VOLUMES AM [MID] (PM) PEAK HOUR EXITING VOLUMES (Randol Mill Ave)FM 1938(Randol Mill Ave)FM 1938 SUITE 1660 972-248-3006 TBPE FIRM F-450 3030 LBJ FREEWAY DALLAS, TEXAS 75234 Exhibit 9 NOT TO SCALENNorthSouthEast West NorthSouthEast West Int. #2 East West North South Int. #1 Int. #3 SITE AP 2 AP C AP B AP 1 AP A Development Full (Southlake Blvd) FM 1709 (Southlake Blvd)FM 1709 Players CirMea do wlark L n12 [13] (9)12 [14] (9)38 [43] (27) LEGEND NOT SIGNALIZED (STUDY INTERSECTION) SIGNALIZED (NOT STUDY INTERSECTION) SIGNALIZED (STUDY INTERSECTION) Total Site Trips (Pass-by & Primary)-6 [-7] (-5)6 [7] (4)-6 [-7] (-5)12 [14] (9)17 [19] (13)6 [7] (4)-9 [-10] (-7) 9 [10] (6) -9 [-10] (-7) -9 [-10] (-7) North South West East Int. A -9 [-10] (-7) +18 [+20] (+13) AM [MID] (PM) PEAK HOUR VOLUMES (Randol Mill Ave)FM 1938(Randol Mill Ave)FM 193817 [ 19] (13) 28 [32] (22) SUITE 1660 972-248-3006 TBPE FIRM F-450 3030 LBJ FREEWAY DALLAS, TEXAS 75234 Exhibit 10 NOT TO SCALENNorthSouthEast West NorthSouthEast West Int. #2 East West North South Int. #1 Int. #3 SITE AP 2 AP C AP B AP 1 AP A Development Full (Southlake Blvd) FM 1709 (Southlake Blvd)FM 1709 Players CirMea do wlark L n 2,540 [1,337] (1,494) 42 [53] (36) 753 [1,179] (2,180) 8 [18] (21) 163 [384] (159) 2 [43] (0) 214 [155] (496) 430 [802] (1,480) 110 [180] (206)23 [21] (54)166 [198] (272)706 [396] (513)560 [162] (369)3 [37] (2)295 [263] (257)390 [364] (869)77 [357] (221)1,683 [937] (940) 159 [180] (202)784 [718] (1,620)1,381 [959] (1,158)42 [54] (55)LEGEND NOT SIGNALIZED (STUDY INTERSECTION) SIGNALIZED (NOT STUDY INTERSECTION) SIGNALIZED (STUDY INTERSECTION) 55 [113] (113) 107 [72] (58) AM [MID] (PM) PEAK HOUR VOLUMES Buildout 2024 Traffic Condition(Randol Mill Ave)FM 1938(Randol Mill Ave)FM 1938 Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 30 Access Point Analys es This study includes the following access point analyses: • Evaluate a need for right turn deceleration lanes. Right Turn Deceleration Lane Analysis This study conducts right-turn deceleration lane analyses at the following intersections: • Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2). • Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3). Guidelines in TxDOT’s Access Management Manual state: • For roadways with a posted speed limit less than or equal to 45 mph, a right turn deceleration lane should be considered when peak right turn volumes are greater than 60 vehicles per hour. • For roadways with a posted speed limit greater than 45 mph, a right turn deceleration lane should be considered when peak right turn volumes are greater than 50 vehicles per hour. Intersection 2 Volumes for Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) fall below the TxDOT threshold (60 vph) for considering a right-turn deceleration lane. Table 3 contains a summary of the right-turn deceleration lane analysis. Table 3. Right-Turn Deceleration Lane Analysis for Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2). Analysis Period Approach Speed Limit (mph) Threshold (vph) Volume (vph) AM [MID] (PM) Exceeds Threshold? AM [MID] (PM) Existing 2023 EB 45 60 13 [20] (13) No [No] (No) Background 2024 EB 45 60 14 [21] (14) No [No] (No) Buildout 2024 EB 45 60 42 [53] (36) No [No] (No) Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 31 Intersection 3 Volumes for Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3) fall below the TxDOT threshold (60 vph) for considering a right-turn deceleration lane. Table 4 contains a summary of the right-turn deceleration lane analysis. Table 4. Right-Turn Deceleration Lane Analysis for Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3). Analysis Period Approach Speed Limit (mph) Threshold (vph) Volume (vph) AM [MID] (PM) Exceeds Threshold? AM [MID] (PM) Existing 2023 NB 45 60 29 [39] (45) No [No] (No) Background 2024 NB 45 60 30 [40] (46) No [No] (No) Buildout 2024 NB 45 60 42 [54] (55) No [No] (No) Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 32 Intersection Capacity Analysis Appendix G contains the traffic signal timing information provide by TxDOT Fort Worth Staff. Unless otherwise indicated, this study used this traffic signal timing information when determining capacity analysis results at any existing traffic signals. Appendix H contains level of service outputs from the Synchro 11 traffic analysis software package. This study also considers peak hour factor by intersection and heavy truck percentage by movement when estimating delay and level of service at study intersections. This study uses the HCM methodologies included within the Synchro 11 traffic analysis software package to evaluate intersection capacity at study intersections. The study intersections are: • FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1). • Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2). • Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3). Delay based intersection Level of Service (LOS) is a qualitative measure of capacity and operating conditions and is directly related to vehicle delay. HCM methodologies give delay-based LOS a letter designation ranging from A to F with LOS A representing short delay and LOS F representing long delay. Table 5 contains the delay-based LOS criteria for signalized and unsignalized intersections. For this study, an acceptable condition is delay-based LOS D or better. An alternative measures of intersection capacity includes volume to capacity ratio (V/C) and 95th percentile queue length. Volume to capacity ratios at or above 0.80 suggest anticipated traffic volumes are starting to exceed the intersections capacity, which could indicate a need for mitigation. 95th percentile queue length indicates a queue length with a 5% probability of the observed queue length exceeding it during the analysis period. Table 6 contains a summary of the evaluated scenarios and associated exhibits. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 33 Table 5. Control Delay Based Level of Service (LOS) Criteria for Signalized and Unsignalized Intersections. Level of Service (LOS) Control Delay (seconds/vehicle) Description Signalized Unsignalized A ≤ 10.0 ≤ 10.0 Very low vehicle delays, free flow, and signal progression extremely favorable. B 10.1 to 20.0 10.1 to 15.0 Good signal progression, more vehicles stop and experience higher delays than for LOS A. C 20.1 to 35.0 15.1 to 25.0 Stable flow, fair signal progression, significant number of vehicles stop at signals. D 35.1 to 55.0 25.1 to 35.0 Congestion noticeable, longer delays and unfavorable signal progression. E 55.1 to 80.0 35.1 to 50.0 Limit of acceptable delay, unstable flow, poor signal progression, traffic near roadway capacity. F > 80.0 > 50.0 Unacceptable delays, extremely unstable flow and congestion, traffic exceeds roadway capacity. SOURCE: Highway Capacity Manual, 6th Edition, Transportation Research Board, 2016 Table 6. Intersection Capacity Analysis Scenarios and Associated Exhibits. Scenario Lane Configurations Traffic Volumes Existing 2023 Exhibit 1 Exhibit 3 Background 2024 Exhibit 1 Exhibit 4 Buildout 2024 Exhibit 2 Exhibit 10 Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 34 Intersection 1 Table 7 contains a summary of the capacity analysis results for Intersection 1. Existing 2023: FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1) falls within the range for Intersection Level of Service F in the AM Peak Hour and E in the Midday and PM Peak Hour. Background 2024: FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1) falls within the range for Intersection Level of Service F in the AM Peak Hour and E in the Midday and PM Peak Hour. Buildout 2024: FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1) falls within the range for Intersection Level of Service F in the AM Peak Hour and E in the Midday and PM Peak Hour. Given level of service and delay are similar in the Background and Buildout traffic conditions, this study does not propose any mitigations at Intersection 1. Table 7. Intersection Capacity Analysis Results for FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1). Scenario Peak Hour Intersection EB WB NB SB Existing 2023 AM 80.3 (F) 82.9 (F) 38.0 (D) 109.5 (F) 61.3 (E) MID 59.7 (E) 44.2 (D) 32.8 (C) 52.9 (D) 119.1 (F) PM 69.8 (E) 51.1 (D) 56.2 (E) 65.2 (E) 114.2 (F) Background 2024 AM 85.8 (F) 90.4 (F) 38.3 (D) 116.9 (F) 63.1 (E) MID 62.3 (E) 46.0 (D) 33.0 (C) 53.4 (D) 127.5 (F) PM 72.6 (E) 51.9 (D) 57.7 (E) 66.9 (E) 121.9 (F) Buildout 2024 AM 87.7 (F) 92.1 (F) 38.3 (D) 118.0 (F) 67.1 (E) MID 63.1 (E) 46.1 (D) 33.1 (C) 54.5 (D) 129.5 (F) PM 73.5 (E) 52.0 (D) 57.4 (E) 71.6 (E) 122.1 (F) 1 HCM methodologies discourage the use of intersection-wide delay for 1-Way & 2-Way Stop Control Analysis. 2 Delay in seconds/vehicle (Level of Service). 3 V/C = Volume to Capacity Ratio. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 35 Intersection 2 Table 8 contains a summary of the capacity analysis results for Intersection 1. Existing 2023: Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) falls within the range for LOS F in the AM Peak Hour with a Volume to Capacity Ratio (V/C) of 0.76. Background 2024: Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) falls within the range for LOS F in the AM Peak Hour with a Volume to Capacity Ratio (V/C) of 0.81. Buildout 2024: Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) falls within the range for LOS F in the AM Peak Hour with a Volume to Capacity Ratio (V/C) of 0.98. This is a worst-case scenario. It is likely reasonable and prudent drivers will redistribute to alternative exits to obtain a more reasonable delay and volume to capacity ratio. Therefore, this study does not propose any mitigations at Intersection 2. Table 8. Intersection Capacity Analysis Results for Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2). Scenario Peak Hour Intersection EB WB NB SB Existing 2023 AM -- -- -- 94.2 (F) V/C = 0.76 -- MID -- -- -- 18.5 (C) -- PM -- -- -- 19.3 (C) -- Background 2024 AM -- -- -- 106.8 (F) V/C = 0.81 -- MID -- -- -- 19.0 (C) -- PM -- -- -- 19.8 (C) -- Buildout 2024 AM -- -- -- 149.0 (F) V/C = 0.98 -- MID -- -- -- 20.4 (C) -- PM -- -- -- 20.9 (C) -- 1 HCM methodologies discourage the use of intersection-wide delay for 1-Way & 2-Way Stop Control Analysis. 2 Delay in seconds/vehicle (Level of Service). 3 V/C = Volume to Capacity Ratio. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 36 Intersection 3 Table 9 contains a summary of the capacity analysis results for Intersection 3. Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3) falls within the range for Level of Service C or better in the evaluated scenarios. Table 9. Intersection Capacity Analysis Results for Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3). Scenario Peak Hour Intersection EB WB NB SB Existing 2023 AM -- -- 19.1 (C) -- -- MID -- -- 15.2 (C) -- -- PM -- -- 19.1 (C) -- -- Background 2024 AM -- -- 19.5 (C) -- -- MID -- -- 15.4 (C) -- -- PM -- -- 19.6 (C) -- -- Buildout 2024 AM -- -- 22.7 (C) -- -- MID -- -- 17.1 (C) -- -- PM -- -- 21.6 (C) -- -- 1 HCM methodologies discourage the use of intersection-wide delay for 1-Way & 2-Way Stop Control Analysis. 2 Delay in seconds/vehicle (Level of Service). 3 V/C = Volume to Capacity Ratio. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 37 Queue Length Analysis This study uses queue length analyses to determine the probability the queue will extend: • Past the End of the Order Lane. • Onto Access 1. • Onto Southlake Blvd. Figure 3 shows the available onsite queuing space associated with the proposed development. It defines the following distances: • Distance A is the storage space from the Pick-Up Window to the Ordering location. This study estimates 9 vehicles can fit in this space. • Distance B is the storage space from the order location to the entry for the drive-thru lane. This study estimates 3 vehicles can fit in this space. • Distance C is the space from the entry to the drive-thru lane to the location of Access 1 as it comes into the development. This study estimates 9 vehicles can fit in this space. • Distance D is the space from the end of Distance C to Southlake Blvd. This study estimates 9 vehicles can fit in this space. Figure 3. Available Queuing Space for Proposed Site Plan. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 38 The developer provided the following information for existing Birdcall Restaurants: • During the Midday Peak Hour (Lunch), the average time in System is 315 seconds/veh. • During the PM Peak Hour (Dinner), the average time in system is 362 seconds/veh. Within this report, the queueing analysis uses a statistical model that assumes a Poisson distribution for vehicle arrivals and an exponential distribution (M/M/1 model) for service times. This model presumes queuing at the proposed location will be a function of: • The Peak Hour Arrival Rate (λ) (veh/hr). • Peak Hour Service Rate (μ) (veh/hr). • Average Time in System (hr/veh). This study presumes 75 % of the vehicles entering the site are the peak hour arrival rate (λ) for the applicable peak hour. The number of vehicles entering the site comes from the trip generation values in Table 2. For the M/M/1 queueing model, the equation for average time in system is: 𝐴𝑣𝑒𝑟𝑎𝑒𝑒 𝑆�ℎ𝑘𝑒 �ℎ𝑘 𝑆𝑦𝑟𝑟𝑒𝑘= 1 (𝜆−𝜆) Since the Average Time in System and Peak Hour Arrival Rate (λ) are known, it is possible to solve the equation to determine Peak Hour Service Rate (μ). Table 10 contains the known values and the calculated Peak Hour Service Rate (μ). Table 10. Variables for Estimating Queue Lengths. For the M/M/1 queueing model, the probability of a certain queue length being more than a specific value of (k) can be determined using the following equation: 𝑃𝑟𝑘𝑎𝑎𝑎�ℎ𝑘�ℎ𝑟𝑦 𝑘𝑒 𝑀𝑘𝑟𝑒 𝑆�𝑎𝑘 "𝑘" 𝑆𝑘�ℎ𝑟𝑟 �ℎ𝑘 𝑟�𝑒 𝑆𝑦𝑟𝑟𝑒𝑘=(𝜆 𝜆) 𝑘+1 For this study, “k” represents storage capacity. Table 11 contains values for “k” associated with the proposed development. Variable Midday Peak Hour PM Peak Hour Number of Entering Trips in Peak Hour (veh)63 42 Anticipated Percent Using Drive-Thru 75%75% Peak Hour Arrival Rate at Order Location, λ (veh/hr)48 32 Average Time in System (sec/veh)315 362 Average Time in System (hrs/veh)0.088 0.101 Calculated Service Rate, μ (veh/hr)60 42 Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 39 Table 11. Storage Capacities for Proposed Development. Table 12 contains the probability of the queue extending to the following locations: • The end of the Order Lane (Distance B). • Access 1 (Distance B + Distance C). • Southlake Blvd (Distance B + Distance C + Distance D). Table 12. Queue Length Probabilities for the Proposed Development. The queue length analysis suggests the probability of a queue extending onto Southlake Blvd during the Midday Peak Hour is 1%; and the probability during the PM Peak Hour is <1%. Additionally, this study presumes Birdcall will either adjust their service time or take steps to have the queue extend into the development (rather than towards the roadway) if queueing issues were to occur. Based upon these results, the proposed site plan has sufficient queueing space for the anticipated demand. Vehicle Storage Area Value for "k" Pickup Window to Order Location (veh)9 Order Location to End of the Order Lane (veh)3 Order Location to Access 1 (veh)12 Order Location to Southlake Blvd (veh)21 Probabiliy of Queue Extending to:Midday Peak Hour PM Peak Hour End of the Order Lane 41%34% Access 1 5%3% Southlake Blvd 1%<1% Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 40 Conclusions This study analyzes the potential traffic impacts of the proposed development: Birdcall Restaurant. The location of the proposed development is east of FM 1938 (Randol Mill Ave) and south of FM 1709 (Southlake Blvd) in Southlake, TX. It will be an out parcel in an existing commercial development. Proposed Development The proposed land use(s) include: • Up to 2,400 square feet gross floor area of Fast-Food Restaurant with Drive-Through Window (ITE Land Use Code 934). The Restaurant will also have a 2,500 square foot patio area. Note: Most Birdcall Restaurants do not serve breakfast. However, this could change in the future, therefore, this report includes an AM Peak Hour analysis. The proposed development does not add any new access points. This study evaluates the following existing access points: • Access Point 1 (AP1): An existing right-in/right-out access along FM 1709 approximately 550 feet east of FM 1938. • Access Point 2 (AP 2): An existing right-in/right-out access along FM 1938 approximately 300 feet south of FM 1709. This study discusses (but does not evaluate) the following existing access points that are part of the larger commercial development. • Access Point A (AP A): An existing right-in/right-out/left-in access along FM 1709 approximately 1,050 feet east of FM 1938. • Access Point B (AP B): An existing right-in/right-out access along FM 1709 approximately 300 feet east of FM 1938. • Access Point C (AP C): An existing right-in/right-out access along FM 1938 approximately 130 feet south of FM 1709. This study estimates the total number of trips entering and exiting the proposed development will be (includes both pass-by and primary trips): • 7,272 Daily Trips. • 108 AM Peak Hour Trips. • 124 Midday Peak Hour Trips. • 80 PM Peak Hour Trips. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 41 Right Turn Deceleration Lane Analysis Access Point 1 (Intersection 2) • Volumes for Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) fall below the TxDOT threshold (60 vph) for considering a right-turn deceleration lane. Access Point 2 (Intersection 3) • Volumes for Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3) fall below the TxDOT threshold (60 vph) for considering a right-turn deceleration lane. Intersection Capacity Analysis Intersection 1 • Existing 2023: FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1) falls within the range for Intersection Level of Service F in the AM Peak Hour and E in the Midday and PM Peak Hour. • Background 2024: FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1) falls within the range for Intersection Level of Service F in the AM Peak Hour and E in the Midday and PM Peak Hour. • Buildout 2024: FM 1709 (Southlake Blvd) at FM 1938 (Randol Mill Ave) (Intersection 1) falls withi n the range for Intersection Level of Service F in the AM Peak Hour and E in the Midday and PM Peak Hour. • Given level of service and delay are similar in the Background and Buildout traffic conditions, this study does not propose any mitigations at Intersection 1. Intersection 2 • Existing 2023: Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) falls within the range for LOS F in the AM Peak Hour with a Volume to Capacity Ratio (V/C) of 0.76. • Background 2024: Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) falls within the range for LOS F in the AM Peak Hour with a Volume to Capacity Ratio (V/C) of 0.81. • Buildout 2024: Access Point 1 (AP 1) at FM 1709 (Southlake Blvd) (Intersection 2) falls within the range for LOS F in the AM Peak Hour with a Volume to Capacity Ratio (V/C) of 0.98. This is a worst-case scenario. • It is likely reasonable and prudent drivers will redistribute to alternative exits to obtain a more reasonable delay and volume to capacity ratio. Therefore, this study does not propose any mitigations at Intersection 2. Intersection 3 • Access Point 2 (AP 2) at FM 1938 (Randol Mill Ave) (Intersection 3) falls within the range for Level of Service C or better in the evaluated scenarios. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 42 Queue Length Analysis • The queue length analysis suggests the probability of a queue extending onto Southlake Blvd during the Midday Peak Hour is 1%; and the probability during the PM Peak Hour is <1%. Additionally, this study presumes Birdcall will either adjust their service time or take steps to have the queue extend into the development (rather than towards the roadway) if queueing issues were to occur. Based upon these results, the proposed site plan has sufficient queueing space for the anticipated demand. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 43 Recommendations Buildout 2024 No mitigations proposed. Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 44 Appendix A – Site Plan 9 9 9 9 8 8 9 9 8 8 8 8 8 8 8 8 8 8 15 12 24 22 14 12 9 9 8 8 9 9 9 9 9 9 26 3 15 5 5 2 6 8 17 5 6 6 2 12 15 4 7 6 4 11 5 14 2 4 6 7 8 14 13 7 8 9.0'EX. BUILDING ZONING C-3 71,301 SF EX. BUILDING ZONING C-3 15,561 SF EX. BUILDING ZONING C-3 20,236 SF 24.0' LOT 5, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 6, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.) LOT 7, BLOCK 1, SOUTHLAKE CROSSING PHASE II (CABINET A, SLIDE 2425, P.R.T.C.T.)25' UTILITY EAS E ME NT CABI N ET A, SLI DE 2425P.R.T.C.T.50' BUIL DI N G LI N E CABI N ET A, SLI DE 2425P.R.T.C.T. 15' UTILITY EASEMENT CABINET A, SLIDE 1613 P.R.T.C.T.50' BUIL DI N G LI N E CABI NET A, SLI DE 1614P.R.T.C.T.10 i.10 i.10 f.10 g.30' SETBA CK (PER Z O NI N G)30' SETBA C K (PER ZO NI N G)25' SETBACK(PER ZONING)25' SETBACK(PER ZONING)10' SETBACK (PER ZONING)10' SETBA CK (PER ZO NI N G) 15' DRAINAGE & UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. 20' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j.15' DRAINAGE & UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. (TRACT 3) 40' PERIMETER ACCESS DRIVE EASEMENT VOLUME 9734, PAGE 478 & VOLUME 11474, PAGE 1894 VOLUME 14393, PAGE 448 48' DRAINAGE EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 i. (TRACT 3) 40' PERIMETER ACCESS DRIVE EASEMENT VOLUME 9734, PAGE 478 & VOLUME 11474, PAGE 1894 VOLUME 14393, PAGE 448 PART OF TRACT 3 40' PERIMETER, ACCESS DRIVE, VOLUME 9734, PAGE 478 & VOLUME 11474, PAGE 1694 VOLUME 14393, PAGE 448 D.R.T.C.T. 48' DRAINAGE & UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 i. 25' COMMON ACCESS EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. 15' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 i. 15' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. 15' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. 25' UTILITY EASEMENT CABINET A, SLIDE 1614 P.R.T.C.T. 10 g. 25' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. 25'X52' COMMON ACCESS EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 i. 35' UTILITY EASEMENT CABINET A, SLIDE 2425 P.R.T.C.T. 10 j. (TRACT 3) 40' PERIMETER ACCESS DRIVE EASEMENT VOLUME 9734, PAGE 478 & VOLUME 11474, PAGE 1894 VOLUME 14393, PAGE 448••••••• ••• ••••••••••••565.00'••••••••••••••••••••••2 2 0 . 0 0 ' ••••• • • • • • • • • • • • • • • • • •80.00'••••••••••••••••••••••1 9 6 . 7 4 '••••••••••••••••••••••114.33'• • • • • • • • • • • • • • • • • • • • • • 1 5 9 . 5 8 '••••••••••••••• • ••••••226.92'••••••••••••••••••••1044.45'••••••••••••••••••••••317.33' ••••• • • • • • • • • • • • • • • • • •65.85'••••••••••••••••••••••1 9 0 . 0 0 ' ••••• • • • • • • • • • • • • • • • • •20.00'••••••••••••••••••••••2 0 5 . 0 0 ' 50' BUILDING LINE CABINET A, SLIDE 2425 P.R.T.C.T. 9. 0 '18.0'(TYP.) R 5'R5' R 5 'R10'R 5' R 5' R5 'R5'R 3'R5'R 5 'R 5 'R5'R5'R5'R5'R10'R 5'R5'R5'R5'R5'R5'R5'R 5 'R5' R 10'18.0'18.0'18.0'18.0'18.0'18.0'18.0'18.0'18.0'9. 0 ' 9. 0 '18.0'9. 0 ' 9. 0 ' 9. 0 ' 9. 0 ' 9. 0 ' 9 . 0 ' 9. 0 ' 9. 0 '24.0'24.0'24.0'24.0'24.0'24.0'24.0'EX. BUILDING ZONING C-3 5,000 SF 15.0'15.0'66.7' PROP. OPEN SPACE PROP. PATIO PROP. PATIO DRIV E THRU 5 0 . 0 '36.7'PROP. SIDEWALK PROP. DUMPSTER PROP. SIDEWALK PROP. SIGN PROP. BUILDING ZONING C-3 4900 SF (INCLUDING 2500 SF PATIO) 6 0 . 0 ' LEGEND FILENAME:C3.0 SITE PLAN_SHP22002.dwgPLOTTED BY: Sydney FosterFULL PATH: K:\Jobs\SHP22002_Southlake Marketplace\Drawings\03 - ProductionK:\Jobs\SHP22002_Southlake Marketplace\Drawings\03 - Production\C3.0 SITE PLAN_SHP22002PLOTTED DATE: 1/5/2023SITE PLAN CITY PROJECT NO. SPXX-XXXX SOUTHLAKE MARKETPLACE 11.646 ACRES LOT 5 & 7, BLOCK 1 ALTA/ACSM LAND TITLE SURVEY (INST. NO. 20190215010000670) CITY OF SOUTHLAKE, TARRANT, TEXAS PREPARATION DATE: XX/XX/XXXX OWNER/APPLICANT SHOP COMPANIES 4809 COLE AVE #330 DALLAS, TX 75205 PH: 214-960-4545 CONTACT: BUCK WHEELER LANDSCAPE ARCHITECT LANDSCAPE ARCHITECT COMAPNY LANDSCAPE ADDRESS LANDSCAPE ADDRESS PH: LANDSCAPE PHONE NUMBER CONTACT: LA ARCHITECT, RLA ENGINEER KIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 PH: 817-488-4960 CONTACT: SHEA KIRKMAN, PE SURVEYOR TEXAS HERITAGE SURVEYING, LLC 10610 METRIC DR, SUITE 124 DALLAS, TX 75243 PH: 214-340-9700 CONTACT: GARY E. JOHNSON, RPLS CONCEPT PLAN GRAPHIC SCALE FEET012060 SCALE: 1" = 60' FIRE LANE STRIPING ACCESSIBLE ROUTE PARKING COUNT PROPERTY BOUNDARY FIRELANE 10 KE PROJECT CLIENT LOGO 4809 COLE AVE #330 DALLAS, TX 75205 214-960-4545 SHEET:REV:DATE:DESCRIPTION:SOUTHLAKEMARKETPLACELOT 5, 6, & 7, BLOCK 1CITY OF SOUTHLAKETARRANT, TEXASKIRKMAN ENGINEERING, LLC 5200 STATE HIGHWAY 121 COLLEYVILLE, TX 76034 TEXAS FIRM NO. 15874 JOB NUMBER: ISSUE DATE: SHP22002 1/5/2023 PRELIMINARY FOR REVIEW ONLY THESE DOCUMENTS ARE FOR DESIGN REVIEW ONLY AND NOT INTENDED FOR THE PURPOSES OF CONSTRUCTION, BIDDING OR PERMIT. THEY WERE PREPARED BY, OR UNDER THE SUPERVISION OF: P.E.# 91865 SHEA O. KIRKMAN DATE: January 5, 2023 SITE PLAN DATA TABLE EXISTING ZONING C-3 PROPOSED ZONING C-3 TOTAL NUMBER OF PROPOSED LOTS 3 TOTAL LOT AREA (SF) / (ACRES)544,897 / 12.509 LOT 5 400,898 / 9.203 LOT 6 37,618 / 0.863 LOT 7 106,381 / 2.442 AREA OF OPEN SPACE (SF)117,590 PERCENTAGE OF OPEN SPACE (%)21.58% REQUIRED PARKING 662 PROVIDED PARKING STANDARD 577 HANDICAP 23 TOTAL 600 TOTAL BUILDING AREA (SF)117,057 BUILDING HEIGHT 24'-0" (1 STORY) # OF STORIES 1 BUILDING LOT COVERAGE (%) / FLOOR AREA RATIO 21.5% / 0.215:1 ANTICIPATED SCHEDULE OF DEVELOPMENT Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 46 Appendix B – Scoping Email 1 James Robertson From:Hetal Bhatt Sent:Friday, January 20, 2023 5:02 PM To:Sandra Endy Cc:Jody Short Subject:RE: Southlake Marketplace Commercial TIA Thank you for taking the time to discuss this scope of work with me. Below are the brief notes on the conversation. Please feel free to comment as you deem fit. 1. LEE will add the stacking analysis to the scope of work 2. The City agrees with the study area and scope of work (with the consideration of item 1) Hetal H. Bhatt, P.E., PTOE Lee Engineering, LLC (972) 456‐9039 direct (682) 556‐1883 mobile From: Hetal Bhatt Sent: Friday, January 20, 2023 3:57 PM To: Sandra Endy <SEndy@ci.southlake.tx.us> Cc: Jody Short <jshort@lee‐eng.com> Subject: RE: Southlake Marketplace Commercial TIA 2 3 Hetal H. Bhatt, P.E., PTOE Lee Engineering, LLC (972) 456‐9039 direct (682) 556‐1883 mobile From: Hetal Bhatt Sent: Friday, January 20, 2023 3:53 PM To: Sandra Endy <SEndy@ci.southlake.tx.us> Cc: Jody Short <jshort@lee‐eng.com> Subject: FW: Southlake Marketplace Commercial TIA Attached per our conversation. Hetal H. Bhatt, P.E., PTOE Lee Engineering, LLC (972) 456‐9039 direct (682) 556‐1883 mobile From: Hetal Bhatt Sent: Monday, January 16, 2023 4:05 PM To: Kevin Ferrer <kferrer@cityofsouthlake.com> Cc: Jody Short <jshort@lee‐eng.com> Subject: Southlake Marketplace Commercial TIA [Filed 16 Jan 2023 16:05] 4 Kevin, Good afternoon. Kirkman Engineering approached us to perform a Traffic Impact Analysis (TIA) for a commercial site in Southlake near the northeast corner of Southlake Boulevard and Davis Boulevard (The site plan and .kmz file are attached). We understand that the City has requested a TIA for the proposed development. Please let us know if the scope of work described below meets the City’s needs or not. If not, please let me know what needs to be added.  Study intersections 1. Davis Boulevard and Southlake Boulevard (Existing) 2. Southlake Boulevard and Second Driveway from the west (Existing) 3. Davis Boulevard and Second Driveway from the north (Existing)  Data collections 1. Collect weekday AM and PM peak period turning movement counts for the existing intersections in the above Task 2. Existing lane configurations for the study area intersections  Trip Generation Estimates 1. Based on the latest edition of the ITE Trip Generation Manual  Pass‐by reductions will be applied, if applicable  Traffic Analysis 1. Intersection capacity analyses for the AM and PM peak hours under the existing and Build‐out Year (background and total) for the study intersections Thank you, HETAL BHATT, PE, PTOE PROJECT MANAGER 3030 LBJ Freeway, Suite 1660 Dallas, TX 75234 (972) 248‐3006 office (972) 456‐9039 direct (682) 556‐1883 mobile www.leeengineering.com Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 51 Appendix C – Turning Movement Count Data SSOOUUTTHHLLAAKKEE BBLLVVDD @@ RANDOL_MILL -- TTMMCCThu Feb 16, 2023 Full Length (6:30 AM-8:30 AM, 4:30 PM-6:30 PM) All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1039820, Location: 32.937605, -97.18582 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg SOUTHLAKE BLVD SOUTHLAKE BLVD DAVIS BLVD DAVIS BLVD Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-02-16 6:30AM 18 291 20 0 329329 19 59 15 1 9494 21 79 73 1 174174 28 41 2 0 7171 668668 6:45AM 25 400 27 3 455455 21 59 14 0 9494 19 97 89 2 207207 27 52 6 3 8888 844844 Hourly Total 43 691 47 3 784784 40 118 29 1 188188 40 176 162 3 381381 55 93 8 3 159159 15121512 7:00AM 28 390 38 1 457457 38 64 11 1 114114 17 114 122 2 255255 41 83 13 0 137137 963963 7:15AM 31 486 42 3 562562 45 69 19 1 134134 23 135 125 0 283283 57 95 18 0 170170 11491149 7:30AM 34 400 27 0 461461 40 110 26 0 176176 31 208 160 2 401401 82 118 22 1 223223 12611261 7:45AM 46 358 40 0 444444 55 128 30 0 213213 34 191 151 7 383383 90 100 21 1 212212 12521252 Hourly Total 139 1634 147 4 19241924 178 371 86 2 637637 105 648 558 11 13221322 270 396 74 2 742742 46254625 8:00AM 48 397 46 4 495495 69 123 32 0 224224 58 152 113 1 324324 48 75 14 0 137137 11801180 8:15AM 35 354 36 0 425425 66 127 28 0 221221 54 144 113 2 313313 51 82 22 1 156156 11151115 8:30AM 0 0 0 0 00 0 0 0 0 00 0 0 0 0 00 0 0 0 0 00 00 Hourly Total 83 751 82 4 920920 135 250 60 0 445445 112 296 226 3 637637 99 157 36 1 293293 22952295 4:30PM 41 220 51 5 317317 119 363 58 0 540540 65 104 83 15 267267 57 207 56 0 320320 14441444 4:45PM 38 236 42 5 321321 105 380 50 0 535535 65 104 81 10 260260 82 194 46 0 322322 14381438 Hourly Total 79 456 93 10 638638 224 743 108 0 10751075 130 208 164 25 527527 139 401 102 0 642642 28822882 5:00PM 40 224 56 6 326326 128 337 51 0 516516 60 138 90 5 293293 55 237 55 1 348348 14831483 5:15PM 36 235 49 4 324324 134 377 42 0 553553 63 153 107 14 337337 49 218 59 0 326326 15401540 5:30PM 35 234 41 4 314314 98 353 61 1 513513 56 126 101 15 298298 50 159 52 0 261261 13861386 5:45PM 36 248 47 13 344344 86 368 41 2 497497 71 119 97 11 298298 47 180 51 1 279279 14181418 Hourly Total 147 941 193 27 13081308 446 1435 195 3 20792079 250 536 395 45 12261226 201 794 217 2 12141214 58275827 6:00PM 25 247 51 8 331331 108 380 63 0 551551 50 116 82 12 260260 60 138 37 3 238238 13801380 6:15PM 26 220 43 7 296296 102 360 56 2 520520 47 115 92 13 267267 70 157 46 4 277277 13601360 Hourly Total 51 467 94 15 627627 210 740 119 2 10711071 97 231 174 25 527527 130 295 83 7 515515 27402740 TotalTotal 542 4940 656 63 62016201 1233 3657 597 8 54955495 734 2095 1679 112 46204620 894 2136 520 15 35653565 1988119881 % Approach% Approach 8.7% 79.7% 10.6% 1.0% --22.4% 66.6% 10.9% 0.1% --15.9% 45.3% 36.3% 2.4% --25.1% 59.9% 14.6% 0.4% --- % Total% Total 2.7% 24.8% 3.3% 0.3% 31.2%31.2%6.2% 18.4% 3.0% 0% 27.6%27.6%3.7% 10.5% 8.4% 0.6% 23.2%23.2%4.5% 10.7% 2.6% 0.1% 17.9%17.9%- LightsLights 539 4910 647 63 61596159 1224 3617 589 8 54385438 720 2063 1659 111 45534553 887 2107 514 15 35233523 19673 % Lights% Lights 99.4% 99.4% 98.6% 100% 99.3%99.3%99.3% 98.9% 98.7% 100% 99.0%99.0%98.1% 98.5% 98.8% 99.1% 98.5%98.5%99.2% 98.6% 98.8% 100% 98.8%98.8%99.0% Articulated TrucksArticulated Trucks 1 8 0 0 99 2 12 1 0 1515 3 8 4 0 1515 1 3 0 0 44 43 % Articulated Trucks% Articulated Trucks 0.2% 0.2% 0% 0% 0.1%0.1%0.2% 0.3% 0.2% 0% 0.3%0.3%0.4% 0.4% 0.2% 0% 0.3%0.3%0.1% 0.1% 0% 0% 0.1%0.1%0.2% Buses and Single-UnitBuses and Single-Unit TrucksTrucks 2 22 9 0 3333 7 28 7 0 4242 11 24 16 1 5252 6 26 6 0 3838 165 % Buses and Single-% Buses and Single- Unit TrucksUnit Trucks 0.4% 0.4% 1.4% 0% 0.5%0.5%0.6% 0.8% 1.2% 0% 0.8%0.8%1.5% 1.1% 1.0% 0.9% 1.1%1.1%0.7% 1.2% 1.2% 0% 1.1%1.1%0.8% *L: Left, R: Right, T: Thru, U: U-Turn SSOOUUTTHHLLAAKKEE BBLLVVDD @@ RANDOL_MILL -- TTMMCCThu Mar 23, 2023 Full Length (11:30 AM-1:30 PM) All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1049337, Location: 32.937605, -97.18582 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg SOUTHLAKE BLVD SOUTHLAKE BLVD DAVIS BLVD DAVIS BLVD Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-03-23 11:30AM 69 172 38 2 281281 43 209 64 5 321321 56 58 33 2 149149 51 73 84 4 212212 963963 11:45AM 72 143 36 6 257257 45 186 53 10 294294 35 90 38 2 165165 64 87 83 10 244244 960960 Hourly Total 141 315 74 8 538538 88 395 117 15 615615 91 148 71 4 314314 115 160 167 14 456456 19231923 12:00PM 79 182 37 7 305305 38 171 63 8 280280 43 94 38 4 179179 56 72 94 7 229229 993993 12:15PM 91 175 35 4 305305 50 176 40 14 280280 45 87 28 4 164164 52 102 92 8 254254 10031003 12:30PM 81 197 38 1 317317 36 210 38 9 293293 43 107 41 0 191191 54 90 67 10 221221 10221022 12:45PM 93 169 35 7 304304 38 188 52 9 287287 40 89 37 2 168168 70 101 114 6 291291 10501050 Hourly Total 344 723 145 19 12311231 162 745 193 40 11401140 171 377 144 10 702702 232 365 367 31 995995 40684068 1:00PM 98 262 52 6 418418 51 198 51 16 316316 49 92 41 4 186186 67 83 82 6 238238 11581158 1:15PM 104 280 51 3 438438 26 200 35 8 269269 43 93 39 1 176176 53 89 87 14 243243 11261126 Hourly Total 202 542 103 9 856856 77 398 86 24 585585 92 185 80 5 362362 120 172 169 20 481481 22842284 TotalTotal 687 1580 322 36 26252625 327 1538 396 79 23402340 354 710 295 19 13781378 467 697 703 65 19321932 82758275 % Approach% Approach 26.2% 60.2% 12.3% 1.4% --14.0% 65.7% 16.9% 3.4% --25.7% 51.5% 21.4% 1.4% --24.2% 36.1% 36.4% 3.4% --- % Total% Total 8.3% 19.1% 3.9% 0.4% 31.7%31.7%4.0% 18.6% 4.8% 1.0% 28.3%28.3%4.3% 8.6% 3.6% 0.2% 16.7%16.7%5.6% 8.4% 8.5% 0.8% 23.3%23.3%- LightsLights 678 1548 314 36 25762576 315 1504 386 79 22842284 351 690 286 19 13461346 457 678 684 65 18841884 8090 % Lights% Lights 98.7% 98.0% 97.5% 100% 98.1%98.1%96.3% 97.8% 97.5% 100% 97.6%97.6%99.2% 97.2% 96.9% 100% 97.7%97.7%97.9% 97.3% 97.3% 100% 97.5%97.5%97.8% Articulated TrucksArticulated Trucks 2 8 2 0 1212 2 9 1 0 1212 0 4 4 0 88 1 5 5 0 1111 43 % Articulated Trucks% Articulated Trucks 0.3% 0.5% 0.6% 0% 0.5%0.5%0.6% 0.6% 0.3% 0% 0.5%0.5%0% 0.6% 1.4% 0% 0.6%0.6%0.2% 0.7% 0.7% 0% 0.6%0.6%0.5% Buses and Single-UnitBuses and Single-Unit TrucksTrucks 7 24 6 0 3737 10 25 9 0 4444 3 16 5 0 2424 9 14 14 0 3737 142 % Buses and Single-% Buses and Single- Unit TrucksUnit Trucks 1.0% 1.5% 1.9% 0% 1.4%1.4%3.1% 1.6% 2.3% 0% 1.9%1.9%0.8% 2.3% 1.7% 0% 1.7%1.7%1.9% 2.0% 2.0% 0% 1.9%1.9%1.7% *L: Left, R: Right, T: Thru, U: U-Turn SSOOUUTTHHLLAAKKEE BBLLVVDD @@ RANDOL_MILL -- TTMMCCThu Feb 16, 2023 AM Peak (7:15 AM - 8:15 AM) All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1039820, Location: 32.937605, -97.18582 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg SOUTHLAKE BLVD SOUTHLAKE BLVD DAVIS BLVD DAVIS BLVD Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-02-16 7:15AM 31 486 42 3 562562 45 69 19 1 134134 23 135 125 0 283283 57 95 18 0 170170 11491149 7:30AM 34 400 27 0 461461 40 110 26 0 176176 31 208 160 2 401401 82 118 22 1 223223 12611261 7:45AM 46 358 40 0 444444 55 128 30 0 213213 34 191 151 7 383383 90 100 21 1 212212 12521252 8:00AM 48 397 46 4 495495 69 123 32 0 224224 58 152 113 1 324324 48 75 14 0 137137 11801180 TotalTotal 159 1641 155 7 19621962 209 430 107 1 747747 146 686 549 10 13911391 277 388 75 2 742742 48424842 % Approach% Approach 8.1% 83.6% 7.9% 0.4% --28.0% 57.6% 14.3% 0.1% --10.5% 49.3% 39.5% 0.7% --37.3% 52.3% 10.1% 0.3% --- % Total% Total 3.3% 33.9% 3.2% 0.1% 40.5%40.5%4.3% 8.9% 2.2% 0% 15.4%15.4%3.0% 14.2% 11.3% 0.2% 28.7%28.7%5.7% 8.0% 1.5% 0% 15.3%15.3%- PHFPHF 0.828 0.844 0.842 0.438 0.8730.873 0.757 0.840 0.836 0.250 0.8340.834 0.629 0.825 0.858 0.357 0.8670.867 0.769 0.822 0.852 0.500 0.8320.832 0.960 LightsLights 157 1633 151 7 19481948 207 416 105 1 729729 142 673 537 9 13611361 273 383 72 2 730730 4768 % Lights% Lights 98.7% 99.5% 97.4% 100% 99.3%99.3%99.0% 96.7% 98.1% 100% 97.6%97.6%97.3% 98.1% 97.8% 90.0% 97.8%97.8%98.6% 98.7% 96.0% 100% 98.4%98.4%98.5% Articulated TrucksArticulated Trucks 1 3 0 0 44 0 1 0 0 11 2 5 2 0 99 1 1 0 0 22 16 % Articulated Trucks% Articulated Trucks 0.6% 0.2% 0% 0% 0.2%0.2%0% 0.2% 0% 0% 0.1%0.1%1.4% 0.7% 0.4% 0% 0.6%0.6%0.4% 0.3% 0% 0% 0.3%0.3%0.3% Buses and Single-UnitBuses and Single-Unit TrucksTrucks 1 5 4 0 1010 2 13 2 0 1717 2 8 10 1 2121 3 4 3 0 1010 58 % Buses and Single-% Buses and Single- Unit TrucksUnit Trucks 0.6% 0.3% 2.6% 0% 0.5%0.5%1.0% 3.0% 1.9% 0% 2.3%2.3%1.4% 1.2% 1.8% 10.0% 1.5%1.5%1.1% 1.0% 4.0% 0% 1.3%1.3%1.2% *L: Left, R: Right, T: Thru, U: U-Turn SSOOUUTTHHLLAAKKEE BBLLVVDD @@ RANDOL_MILL -- TTMMCCThu Mar 23, 2023 Midday Peak (12:30 PM - 1:30 PM) - Overall Peak Hour All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1049337, Location: 32.937605, -97.18582 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg SOUTHLAKE BLVD SOUTHLAKE BLVD DAVIS BLVD DAVIS BLVD Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-03-23 12:30PM 81 197 38 1 317317 36 210 38 9 293293 43 107 41 0 191191 54 90 67 10 221221 10221022 12:45PM 93 169 35 7 304304 38 188 52 9 287287 40 89 37 2 168168 70 101 114 6 291291 10501050 1:00PM 98 262 52 6 418418 51 198 51 16 316316 49 92 41 4 186186 67 83 82 6 238238 11581158 1:15PM 104 280 51 3 438438 26 200 35 8 269269 43 93 39 1 176176 53 89 87 14 243243 11261126 TotalTotal 376 908 176 17 14771477 151 796 176 42 11651165 175 381 158 7 721721 244 363 350 36 993993 43564356 % Approach% Approach 25.5% 61.5% 11.9% 1.2% --13.0% 68.3% 15.1% 3.6% --24.3% 52.8% 21.9% 1.0% --24.6% 36.6% 35.2% 3.6% --- % Total% Total 8.6% 20.8% 4.0% 0.4% 33.9%33.9%3.5% 18.3% 4.0% 1.0% 26.7%26.7%4.0% 8.7% 3.6% 0.2% 16.6%16.6%5.6% 8.3% 8.0% 0.8% 22.8%22.8%- PHFPHF 0.904 0.811 0.846 0.607 0.8430.843 0.740 0.948 0.846 0.656 0.9220.922 0.893 0.890 0.963 0.438 0.9440.944 0.871 0.899 0.768 0.643 0.8530.853 0.940 LightsLights 370 895 174 17 14561456 145 774 172 42 11331133 174 376 156 7 713713 238 355 342 36 971971 4273 % Lights% Lights 98.4% 98.6% 98.9% 100% 98.6%98.6%96.0%97.2% 97.7% 100% 97.3%97.3%99.4% 98.7% 98.7% 100% 98.9%98.9%97.5% 97.8% 97.7% 100% 97.8%97.8%98.1% Articulated TrucksArticulated Trucks 1 4 0 0 55 1 4 1 0 66 0 0 1 0 11 1 3 1 0 55 17 % Articulated Trucks% Articulated Trucks 0.3% 0.4% 0% 0% 0.3%0.3%0.7% 0.5% 0.6% 0% 0.5%0.5%0% 0% 0.6% 0% 0.1%0.1%0.4% 0.8% 0.3% 0% 0.5%0.5%0.4% Buses and Single-UnitBuses and Single-Unit TrucksTrucks 5 9 2 0 1616 5 18 3 0 2626 1 5 1 0 77 5 5 7 0 1717 66 % Buses and Single-% Buses and Single- Unit TrucksUnit Trucks 1.3% 1.0% 1.1% 0% 1.1%1.1%3.3% 2.3% 1.7% 0% 2.2%2.2%0.6% 1.3% 0.6% 0% 1.0%1.0%2.0% 1.4% 2.0% 0% 1.7%1.7%1.5% *L: Left, R: Right, T: Thru, U: U-Turn SSOOUUTTHHLLAAKKEE BBLLVVDD @@ RANDOL_MILL -- TTMMCCThu Feb 16, 2023 PM Peak (4:30 PM - 5:30 PM) - Overall Peak Hour All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1039820, Location: 32.937605, -97.18582 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg SOUTHLAKE BLVD SOUTHLAKE BLVD DAVIS BLVD DAVIS BLVD Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-02-16 4:30PM 41 220 51 5 317317 119 363 58 0 540540 65 104 83 15 267267 57 207 56 0 320320 14441444 4:45PM 38 236 42 5 321321 105 380 50 0 535535 65 104 81 10 260260 82 194 46 0 322322 14381438 5:00PM 40 224 56 6 326326 128 337 51 0 516516 60 138 90 5 293293 55 237 55 1 348348 14831483 5:15PM 36 235 49 4 324324 134 377 42 0 553553 63 153 107 14 337337 49 218 59 0 326326 15401540 TotalTotal 155 915 198 20 12881288 486 1457 201 0 21442144 253 499 361 44 11571157 243 856 216 1 13161316 59055905 % Approach% Approach 12.0% 71.0% 15.4% 1.6% --22.7% 68.0% 9.4% 0% --21.9% 43.1% 31.2% 3.8% --18.5% 65.0% 16.4% 0.1% --- % Total% Total 2.6% 15.5% 3.4% 0.3% 21.8%21.8%8.2% 24.7% 3.4% 0% 36.3%36.3%4.3% 8.5% 6.1% 0.7% 19.6%19.6%4.1% 14.5% 3.7% 0% 22.3%22.3%- PHFPHF 0.945 0.969 0.884 0.833 0.9880.988 0.907 0.959 0.866 - 0.9690.969 0.973 0.815 0.843 0.733 0.8580.858 0.741 0.903 0.915 0.250 0.9450.945 0.959 LightsLights 155 908 197 20 12801280 484 1448 201 0 21332133 250 495 359 44 11481148 243 844 214 1 13021302 5863 % Lights% Lights 100% 99.2% 99.5% 100% 99.4%99.4%99.6% 99.4% 100% 0% 99.5%99.5%98.8% 99.2% 99.4% 100% 99.2%99.2%100% 98.6% 99.1% 100% 98.9%98.9%99.3% Articulated TrucksArticulated Trucks 0 3 0 0 33 0 3 0 0 33 1 1 0 0 22 0 1 0 0 11 9 % Articulated Trucks% Articulated Trucks 0% 0.3% 0% 0% 0.2%0.2%0% 0.2% 0% 0% 0.1%0.1%0.4% 0.2% 0% 0% 0.2%0.2%0% 0.1% 0% 0% 0.1%0.1%0.2% Buses and Single-UnitBuses and Single-Unit TrucksTrucks 0 4 1 0 55 2 6 0 0 88 2 3 2 0 77 0 11 2 0 1313 33 % Buses and Single-Unit% Buses and Single-Unit TrucksTrucks 0% 0.4% 0.5% 0% 0.4%0.4%0.4% 0.4% 0% 0% 0.4%0.4%0.8% 0.6% 0.6% 0% 0.6%0.6%0% 1.3% 0.9% 0% 1.0%1.0%0.6% *L: Left, R: Right, T: Thru, U: U-Turn SOUTHLAKE BLVD @ SECOND DWY FROM W - TMCSOUTHLAKE BLVD @ SECOND DWY FROM W - TMC Thu Feb 16, 2023 Full Length (6:30 AM-8:30 AM, 4:30 PM-6:30 PM) All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1039824, Location: 32.938522, -97.184187 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg SOUTHLAKE BLVD SOUTHLAKE BLVD COMMERCIAL DWY COMMERCIAL DWY Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-02-16 6:30AM 0 405 0 0 405405 0 109 1 0 110110 0 0 11 0 1111 0 0 0 0 00 526526 6:45AM 0 519 0 0 519519 0 85 0 0 8585 0 0 11 0 1111 0 0 0 0 00 615615 Hourly Total 0 924 0 0 924924 0 194 1 0 195195 0 0 22 0 2222 0 0 0 0 00 11411141 7:00AM 0 520 0 0 520520 0 124 0 0 124124 0 0 16 0 1616 0 0 1 0 11 661661 7:15AM 0 712 1 0 713713 0 154 0 0 154154 0 0 19 0 1919 0 0 1 0 11 887887 7:30AM 0 653 4 0 657657 0 177 0 0 177177 0 0 27 0 2727 0 0 0 0 00 861861 7:45AM 0 586 5 0 591591 0 204 0 0 204204 0 0 25 0 2525 0 0 1 0 11 821821 Hourly Total 0 2471 10 0 24812481 0 659 0 0 659659 0 0 87 0 8787 0 0 3 0 33 32303230 8:00AM 0 548 3 0 551551 0 224 1 0 225225 0 0 17 0 1717 0 0 0 0 00 793793 8:15AM 0 531 3 0 534534 0 197 0 0 197197 0 0 23 0 2323 0 0 1 0 11 755755 8:30AM 0 0 0 0 00 0 0 0 0 00 0 0 0 0 00 0 0 0 0 00 00 Hourly Total 0 1079 6 0 10851085 0 421 1 0 422422 0 0 40 0 4040 0 0 1 0 11 15481548 4:30PM 0 344 4 0 348348 0 537 5 0 542542 0 0 16 0 1616 0 0 0 0 00 906906 4:45PM 0 387 4 0 391391 0 539 3 0 542542 0 0 6 0 66 0 0 2 0 22 941941 Hourly Total 0 731 8 0 739739 0 1076 8 0 10841084 0 0 22 0 2222 0 0 2 0 22 18471847 5:00PM 0 360 2 0 362362 0 552 1 0 553553 0 0 12 0 1212 0 0 0 0 00 927927 5:15PM 0 380 3 0 383383 0 506 1 0 507507 0 0 10 0 1010 0 0 0 0 00 900900 5:30PM 0 382 5 0 387387 0 274 4 0 278278 0 0 13 0 1313 0 0 0 0 00 678678 5:45PM 0 382 5 0 387387 0 256 2 0 258258 0 0 5 0 55 0 0 0 0 00 650650 Hourly Total 0 1504 15 0 15191519 0 1588 8 0 15961596 0 0 40 0 4040 0 0 0 0 00 31553155 6:00PM 0 353 5 0 358358 0 298 2 0 300300 0 0 8 0 88 0 0 0 0 00 666666 6:15PM 0 377 4 0 381381 0 280 3 0 283283 0 0 9 0 99 0 0 0 0 00 673673 6:30PM 0 0 0 0 00 0 0 0 0 00 0 0 0 0 00 0 0 0 0 00 00 Hourly Total 0 730 9 0 739739 0 578 5 0 583583 0 0 17 0 1717 0 0 0 0 00 13391339 TotalTotal 0 7439 48 0 74877487 0 4516 23 0 45394539 0 0 228 0 228228 0 0 6 0 66 1226012260 % Approach% Approach 0% 99.4% 0.6% 0% --0% 99.5% 0.5% 0% --0% 0% 100% 0% --0% 0% 100% 0% --- % Total% Total 0% 60.7% 0.4% 0% 61.1%61.1%0% 36.8% 0.2% 0% 37.0%37.0%0% 0% 1.9% 0% 1.9%1.9%0% 0% 0% 0% 0%0%- LightsLights 0 7377 48 0 74257425 0 4459 23 0 44824482 0 0 228 0 228228 0 0 5 0 55 12140 % Lights% Lights 0% 99.2% 100% 0% 99.2%99.2%0% 98.7% 100% 0% 98.7%98.7%0% 0% 100% 0% 100%100%0% 0% 83.3% 0% 83.3%83.3%99.0% Articulated TrucksArticulated Trucks 0 15 0 0 1515 0 16 0 0 1616 0 0 0 0 00 0 0 0 0 00 31 % Articulated Trucks% Articulated Trucks 0% 0.2% 0% 0% 0.2%0.2%0% 0.4% 0% 0% 0.4%0.4%0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%0.3% Buses and Single-Unit TrucksBuses and Single-Unit Trucks 0 47 0 0 4747 0 41 0 0 4141 0 0 0 0 00 0 0 1 0 11 89 % Buses and Single-Unit Trucks% Buses and Single-Unit Trucks 0% 0.6% 0% 0% 0.6%0.6%0% 0.9% 0% 0% 0.9%0.9%0% 0% 0% 0% 0%0%0% 0% 16.7% 0% 16.7%16.7%0.7% *L: Left, R: Right, T: Thru, U: U-Turn SOUTHLAKE BLVD @ SECOND DWY FROM W - TMCSOUTHLAKE BLVD @ SECOND DWY FROM W - TMC Thu Mar 23, 2023 Full Length (11:30 AM-1:30 PM) All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1049339, Location: 32.938522, -97.184187 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg SOUTHLAKE BLVD SOUTHLAKE BLVD SECOND DWY FROM W COMMERCIAL DWY Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-03-23 11:30AM 0 357 7 0 364364 0 305 1 0 306306 0 0 11 0 1111 0 0 2 0 22 683683 11:45AM 0 338 4 0 342342 0 302 2 0 304304 0 0 13 0 1313 0 0 1 0 11 660660 Hourly Total 0 695 11 0 706706 0 607 3 0 610610 0 0 24 0 2424 0 0 3 0 33 13431343 12:00PM 0 340 3 0 343343 0 369 1 0 370370 0 0 10 0 1010 0 0 7 0 77 730730 12:15PM 0 338 8 0 346346 0 328 1 0 329329 0 0 14 0 1414 0 0 4 0 44 693693 12:30PM 0 321 3 0 324324 0 331 1 0 332332 0 0 10 0 1010 0 0 3 0 33 669669 12:45PM 0 354 7 0 361361 0 302 0 0 302302 0 0 14 0 1414 0 0 1 0 11 678678 Hourly Total 0 1353 21 0 13741374 0 1330 3 0 13331333 0 0 48 0 4848 0 0 15 0 1515 27702770 1:00PM 0 329 4 0 333333 0 402 5 0 407407 0 0 13 0 1313 0 0 2 0 22 755755 1:15PM 0 316 6 0 322322 0 407 2 0 409409 0 0 14 0 1414 0 0 0 0 00 745745 Hourly Total 0 645 10 0 655655 0 809 7 0 816816 0 0 27 0 2727 0 0 2 0 22 15001500 TotalTotal 0 2693 42 0 27352735 0 2746 13 0 27592759 0 0 99 0 9999 0 0 20 0 2020 56135613 % Approach% Approach 0% 98.5% 1.5% 0% --0% 99.5% 0.5% 0% --0% 0% 100% 0% --0% 0% 100% 0% --- % Total% Total 0% 48.0% 0.7% 0% 48.7%48.7%0% 48.9% 0.2% 0% 49.2%49.2%0% 0% 1.8% 0% 1.8%1.8%0% 0% 0.4% 0% 0.4%0.4%- LightsLights 0 2635 42 0 26772677 0 2703 11 0 27142714 0 0 99 0 9999 0 0 20 0 2020 5510 % Lights% Lights 0% 97.8% 100% 0% 97.9%97.9%0% 98.4% 84.6% 0% 98.4%98.4%0% 0% 100% 0% 100%100%0% 0% 100% 0% 100%100%98.2% Articulated TrucksArticulated Trucks 0 13 0 0 1313 0 7 0 0 77 0 0 0 0 00 0 0 0 0 00 20 % Articulated Trucks% Articulated Trucks 0% 0.5% 0% 0% 0.5%0.5%0% 0.3% 0% 0% 0.3%0.3%0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%0.4% Buses and Single-Unit TrucksBuses and Single-Unit Trucks 0 45 0 0 4545 0 36 2 0 3838 0 0 0 0 00 0 0 0 0 00 83 % Buses and Single-Unit Trucks% Buses and Single-Unit Trucks 0% 1.7% 0% 0% 1.6%1.6%0% 1.3% 15.4% 0% 1.4%1.4%0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%1.5% *L: Left, R: Right, T: Thru, U: U-Turn SOUTHLAKE BLVD @ SECOND DWY FROM W - TMCSOUTHLAKE BLVD @ SECOND DWY FROM W - TMC Thu Feb 16, 2023 AM Peak (7:15 AM - 8:15 AM) All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1039824, Location: 32.938522, -97.184187 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg SOUTHLAKE BLVD SOUTHLAKE BLVD COMMERCIAL DWY COMMERCIAL DWY Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-02-16 7:15AM 0 712 1 0 713713 0 154 0 0 154154 0 0 19 0 1919 0 0 1 0 11 887887 7:30AM 0 653 4 0 657657 0 177 0 0 177177 0 0 27 0 2727 0 0 0 0 00 861861 7:45AM 0 586 5 0 591591 0 204 0 0 204204 0 0 25 0 2525 0 0 1 0 11 821821 8:00AM 0 548 3 0 551551 0 224 1 0 225225 0 0 17 0 1717 0 0 0 0 00 793793 TotalTotal 0 2499 13 0 25122512 0 759 1 0 760760 0 0 88 0 8888 0 0 2 0 22 33623362 % Approach% Approach 0% 99.5% 0.5% 0% --0% 99.9% 0.1% 0% --0% 0% 100% 0% --0% 0% 100% 0% --- % Total% Total 0% 74.3% 0.4% 0% 74.7%74.7%0% 22.6% 0% 0% 22.6%22.6%0% 0% 2.6% 0% 2.6%2.6%0% 0% 0.1% 0% 0.1%0.1%- PHFPHF - 0.877 0.650 - 0.8810.881 - 0.847 0.250 - 0.8440.844 - - 0.815 - 0.8150.815 - - 0.500 - 0.5000.500 0.948 LightsLights 0 2471 13 0 24842484 0 739 1 0 740740 0 0 88 0 8888 0 0 2 0 22 3314 % Lights% Lights 0% 98.9% 100% 0% 98.9%98.9%0% 97.4% 100% 0% 97.4%97.4%0% 0% 100% 0% 100%100%0% 0% 100% 0% 100%100%98.6% Articulated TrucksArticulated Trucks 0 7 0 0 77 0 1 0 0 11 0 0 0 0 00 0 0 0 0 00 8 % Articulated Trucks% Articulated Trucks 0% 0.3% 0% 0% 0.3%0.3%0% 0.1% 0% 0% 0.1%0.1%0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%0.2% Buses and Single-Unit TrucksBuses and Single-Unit Trucks 0 21 0 0 2121 0 19 0 0 1919 0 0 0 0 00 0 0 0 0 00 40 % Buses and Single-Unit Trucks% Buses and Single-Unit Trucks 0% 0.8% 0% 0% 0.8%0.8%0% 2.5% 0% 0% 2.5%2.5%0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%1.2% *L: Left, R: Right, T: Thru, U: U-Turn SOUTHLAKE BLVD @ SECOND DWY FROM W - TMCSOUTHLAKE BLVD @ SECOND DWY FROM W - TMC Thu Mar 23, 2023 Midday Peak (12:30 PM - 1:30 PM) - Overall Peak Hour All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1049339, Location: 32.938522, -97.184187 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg SOUTHLAKE BLVD SOUTHLAKE BLVD SECOND DWY FROM W COMMERCIAL DWY Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-03-23 12:30PM 0 321 3 0 324324 0 331 1 0 332332 0 0 10 0 1010 0 0 3 0 33 669669 12:45PM 0 354 7 0 361361 0 302 0 0 302302 0 0 14 0 1414 0 0 1 0 11 678678 1:00PM 0 329 4 0 333333 0 402 5 0 407407 0 0 13 0 1313 0 0 2 0 22 755755 1:15PM 0 316 6 0 322322 0 407 2 0 409409 0 0 14 0 1414 0 0 0 0 00 745745 TotalTotal 0 1320 20 0 13401340 0 1442 8 0 14501450 0 0 51 0 5151 0 0 6 0 66 28472847 % Approach% Approach 0% 98.5% 1.5% 0% --0% 99.4% 0.6% 0% --0% 0% 100% 0% --0% 0% 100% 0% --- % Total% Total 0% 46.4% 0.7% 0% 47.1%47.1%0% 50.6% 0.3% 0% 50.9%50.9%0% 0% 1.8% 0% 1.8%1.8%0% 0% 0.2% 0% 0.2%0.2%- PHFPHF - 0.932 0.714 - 0.9280.928 - 0.886 0.400 - 0.8860.886 - - 0.911 - 0.9110.911 - - 0.500 - 0.5000.500 0.943 LightsLights 0 1292 20 0 13121312 0 1421 6 0 14271427 0 0 51 0 5151 0 0 6 0 66 2796 % Lights% Lights 0% 97.9% 100% 0% 97.9%97.9%0%98.5% 75.0% 0% 98.4%98.4%0% 0% 100% 0% 100%100%0% 0% 100% 0% 100%100%98.2% Articulated TrucksArticulated Trucks 0 3 0 0 33 0 3 0 0 33 0 0 0 0 00 0 0 0 0 00 6 % Articulated Trucks% Articulated Trucks 0% 0.2% 0% 0% 0.2%0.2%0% 0.2% 0% 0% 0.2%0.2%0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%0.2% Buses and Single-Unit TrucksBuses and Single-Unit Trucks 0 25 0 0 2525 0 18 2 0 2020 0 0 0 0 00 0 0 0 0 00 45 % Buses and Single-Unit Trucks% Buses and Single-Unit Trucks 0% 1.9% 0% 0% 1.9%1.9%0% 1.2% 25.0% 0% 1.4%1.4%0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%1.6% *L: Left, R: Right, T: Thru, U: U-Turn SOUTHLAKE BLVD @ SECOND DWY FROM W - TMCSOUTHLAKE BLVD @ SECOND DWY FROM W - TMC Thu Feb 16, 2023 PM Peak (4:30 PM - 5:30 PM) - Overall Peak Hour All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1039824, Location: 32.938522, -97.184187 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg SOUTHLAKE BLVD SOUTHLAKE BLVD COMMERCIAL DWY COMMERCIAL DWY Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-02-16 4:30PM 0 344 4 0 348348 0 537 5 0 542542 0 0 16 0 1616 0 0 0 0 00 906906 4:45PM 0 387 4 0 391391 0 539 3 0 542542 0 0 6 0 66 0 0 2 0 22 941941 5:00PM 0 360 2 0 362362 0 552 1 0 553553 0 0 12 0 1212 0 0 0 0 00 927927 5:15PM 0 380 3 0 383383 0 506 1 0 507507 0 0 10 0 1010 0 0 0 0 00 900900 TotalTotal 0 1471 13 0 14841484 0 2134 10 0 21442144 0 0 44 0 4444 0 0 2 0 22 36743674 % Approach% Approach 0% 99.1% 0.9% 0% --0% 99.5% 0.5% 0% --0% 0% 100% 0% --0% 0% 100% 0% --- % Total% Total 0% 40.0% 0.4% 0% 40.4%40.4%0% 58.1% 0.3% 0% 58.4%58.4%0% 0% 1.2% 0% 1.2%1.2%0% 0% 0.1% 0% 0.1%0.1%- PHFPHF - 0.950 0.813 - 0.9490.949 - 0.966 0.500 - 0.9690.969 - - 0.688 - 0.6880.688 - - 0.250 - 0.2500.250 0.976 LightsLights 0 1463 13 0 14761476 0 2120 10 0 21302130 0 0 44 0 4444 0 0 2 0 22 3652 % Lights% Lights 0% 99.5% 100% 0% 99.5%99.5%0% 99.3% 100% 0% 99.3%99.3%0% 0% 100% 0% 100%100%0% 0% 100% 0% 100%100%99.4% Articulated TrucksArticulated Trucks 0 4 0 0 44 0 4 0 0 44 0 0 0 0 00 0 0 0 0 00 8 % Articulated Trucks% Articulated Trucks 0% 0.3% 0% 0% 0.3%0.3%0% 0.2% 0% 0% 0.2%0.2%0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%0.2% Buses and Single-Unit TrucksBuses and Single-Unit Trucks 0 4 0 0 44 0 10 0 0 1010 0 0 0 0 00 0 0 0 0 00 14 % Buses and Single-Unit Trucks% Buses and Single-Unit Trucks 0% 0.3% 0% 0% 0.3%0.3%0% 0.5% 0% 0% 0.5%0.5%0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%0.4% *L: Left, R: Right, T: Thru, U: U-Turn RANDOLL_MILL @@ SSEECCOONNDD DDWWYY FFRROOMM NN -- TTMMCCThu Feb 16, 2023 Full Length (6:30 AM-8:30 AM, 4:30 PM-6:30 PM) All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1039821, Location: 32.936627, -97.185676 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg COMMERCIAL DWY N SECOND DWY DAVIS BLVD DAVIS BLVD Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-02-16 6:30AM 0 0 0 0 00 0 0 2 0 22 0 187 5 0 192192 0 0 0 0 00 194194 6:45AM 0 0 0 0 00 0 0 1 0 11 0 210 7 0 217217 0 0 0 0 00 218218 Hourly Total 0 0 0 0 00 0 0 3 0 33 0 397 12 0 409409 0 0 0 0 00 412412 7:00AM 0 0 0 0 00 0 0 4 0 44 0 247 5 0 252252 0 0 0 0 00 256256 7:15AM 0 0 0 0 00 0 0 3 0 33 0 309 8 0 317317 0 0 0 0 00 320320 7:30AM 0 0 0 0 00 0 0 3 0 33 0 390 7 0 397397 0 0 0 0 00 400400 7:45AM 0 0 0 0 00 0 0 4 0 44 0 339 4 0 343343 0 0 0 0 00 347347 Hourly Total 0 0 0 0 00 0 0 14 0 1414 0 1285 24 0 13091309 0 0 0 0 00 13231323 8:00AM 0 0 0 0 00 0 0 3 0 33 0 311 10 0 321321 0 0 0 0 00 324324 8:15AM 0 0 0 0 00 0 0 6 0 66 0 319 8 0 327327 0 0 0 0 00 333333 Hourly Total 0 0 0 0 00 0 0 9 0 99 0 630 18 0 648648 0 0 0 0 00 657657 4:30PM 0 0 0 0 00 0 0 19 0 1919 0 243 18 0 261261 0 0 0 0 00 280280 4:45PM 0 0 0 0 00 0 0 16 0 1616 0 277 8 0 285285 0 0 0 0 00 301301 Hourly Total 0 0 0 0 00 0 0 35 0 3535 0 520 26 0 546546 0 0 0 0 00 581581 5:00PM 0 0 0 0 00 0 0 19 0 1919 0 277 13 0 290290 0 0 0 0 00 309309 5:15PM 0 0 0 0 00 0 0 22 0 2222 0 311 17 0 328328 0 0 0 0 00 350350 5:30PM 0 0 0 1 11 0 0 27 0 2727 0 275 7 0 282282 0 0 0 0 00 310310 5:45PM 0 0 0 0 00 0 0 18 0 1818 0 251 14 0 265265 0 0 0 0 00 283283 Hourly Total 0 0 0 1 11 0 0 86 0 8686 0 1114 51 0 11651165 0 0 0 0 00 12521252 6:00PM 0 0 0 0 00 0 0 27 0 2727 0 244 10 0 254254 0 0 0 0 00 281281 6:15PM 0 0 0 0 00 0 0 20 0 2020 0 236 8 0 244244 0 0 0 0 00 264264 6:30PM 0 0 0 0 00 0 0 0 0 00 0 0 0 0 00 0 0 0 0 00 00 Hourly Total 0 0 0 0 00 0 0 47 0 4747 0 480 18 0 498498 0 0 0 0 00 545545 TotalTotal 0 0 0 1 11 0 0 194 0 194194 0 4426 149 0 45754575 0 0 0 0 00 47704770 % Approach% Approach 0% 0% 0% 100% --0% 0% 100% 0% --0% 96.7% 3.3% 0% --0% 0% 0% 0% --- % Total% Total 0% 0% 0% 0% 0%0%0% 0% 4.1% 0% 4.1%4.1%0% 92.8% 3.1% 0% 95.9%95.9%0% 0% 0% 0% 0%0%- LightsLights 0 0 0 1 11 0 0 193 0 193193 0 4357 149 0 45064506 0 0 0 0 00 4700 % Lights% Lights 0% 0% 0% 100% 100%100%0% 0% 99.5% 0% 99.5%99.5%0% 98.4% 100% 0% 98.5%98.5%0% 0% 0% 0% --98.5% Articulated TrucksArticulated Trucks 0 0 0 0 00 0 0 0 0 00 0 13 0 0 1313 0 0 0 0 00 13 % Articulated Trucks% Articulated Trucks 0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%0% 0.3% 0% 0% 0.3%0.3%0% 0% 0% 0% --0.3% Buses and Single-Unit TrucksBuses and Single-Unit Trucks 0 0 0 0 00 0 0 1 0 11 0 56 0 0 5656 0 0 0 0 00 57 % Buses and Single-Unit Trucks% Buses and Single-Unit Trucks 0% 0% 0% 0% 0%0%0% 0% 0.5% 0% 0.5%0.5%0% 1.3% 0% 0% 1.2%1.2%0% 0% 0% 0% --1.2% *L: Left, R: Right, T: Thru, U: U-Turn RANDOL_MILL @@ SSEECCOONNDD DDWWYY FFRROOMM NN -- TTMMCCThu Mar 23, 2023 Full Length (11:30 AM-1:30 PM) All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1049338, Location: 32.936627, -97.185676 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg West SECOND DWY FROM N DAVIS BLVD DAVIS BLVD Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-03-23 11:30AM 0 0 0 0 00 0 0 21 0 2121 0 221 10 0 231231 0 198 4 0 202202 454454 11:45AM 0 0 0 0 00 0 0 11 0 1111 0 219 12 0 231231 0 248 8 0 256256 498498 Hourly Total 0 0 0 0 00 0 0 32 0 3232 0 440 22 0 462462 0 446 12 0 458458 952952 12:00PM 0 0 0 0 00 0 0 13 0 1313 0 231 6 0 237237 0 237 6 0 243243 493493 12:15PM 0 0 0 0 00 0 0 20 0 2020 0 232 10 0 242242 0 239 7 0 246246 508508 12:30PM 0 0 0 0 00 0 0 12 0 1212 0 220 2 0 222222 0 224 8 0 232232 466466 12:45PM 0 0 0 0 00 0 0 16 0 1616 0 275 12 0 287287 0 219 5 0 224224 527527 Hourly Total 0 0 0 0 00 0 0 61 0 6161 0 958 30 0 988988 0 919 26 0 945945 19941994 1:00PM 0 0 0 0 00 0 0 18 0 1818 0 214 13 0 227227 0 235 4 0 239239 484484 1:15PM 0 0 0 0 00 0 0 22 0 2222 0 238 12 0 250250 0 246 13 0 259259 531531 1:30PM 0 0 0 0 00 0 0 0 0 00 0 0 0 0 00 0 0 0 0 00 00 Hourly Total 0 0 0 0 00 0 0 40 0 4040 0 452 25 0 477477 0 481 17 0 498498 10151015 TotalTotal 0 0 0 0 00 0 0 133 0 133133 0 1850 77 0 19271927 0 1846 55 0 19011901 39613961 % Approach% Approach 0% 0% 0% 0% --0% 0% 100% 0% --0% 96.0% 4.0% 0% --0% 97.1% 2.9% 0% --- % Total% Total 0% 0% 0% 0% 0%0%0% 0% 3.4% 0% 3.4%3.4%0% 46.7% 1.9% 0% 48.6%48.6%0% 46.6% 1.4% 0% 48.0%48.0%- LightsLights 0 0 0 0 00 0 0 133 0 133133 0 1803 76 0 18791879 0 1817 55 0 18721872 3884 % Lights% Lights 0% 0% 0% 0% --0% 0% 100% 0% 100%100%0% 97.5% 98.7% 0% 97.5%97.5%0% 98.4% 100% 0% 98.5%98.5%98.1% Articulated TrucksArticulated Trucks 0 0 0 0 00 0 0 0 0 00 0 12 0 0 1212 0 6 0 0 66 18 % Articulated Trucks% Articulated Trucks 0% 0% 0% 0% --0% 0% 0% 0% 0%0%0% 0.6% 0% 0% 0.6%0.6%0% 0.3% 0% 0% 0.3%0.3%0.5% Buses and Single-Unit TrucksBuses and Single-Unit Trucks 0 0 0 0 00 0 0 0 0 00 0 35 1 0 3636 0 23 0 0 2323 59 % Buses and Single-Unit Trucks% Buses and Single-Unit Trucks 0% 0% 0%0% --0% 0% 0% 0% 0%0%0% 1.9% 1.3% 0% 1.9%1.9%0% 1.2% 0% 0% 1.2%1.2%1.5% *L: Left, R: Right, T: Thru, U: U-Turn RANDOLL_MILL @@ SSEECCOONNDD DDWWYY FFRROOMM NN -- TTMMCCThu Feb 16, 2023 AM Peak (7:30 AM - 8:30 AM) - Overall Peak Hour All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1039821, Location: 32.936627, -97.185676 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg COMMERCIAL DWY N SECOND DWY DAVIS BLVD DAVIS BLVD Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-02-16 7:30AM 0 0 0 0 00 0 0 3 0 33 0 390 7 0 397397 0 0 0 0 00 400400 7:45AM 0 0 0 0 00 0 0 4 0 44 0 339 4 0 343343 0 0 0 0 00 347347 8:00AM 0 0 0 0 00 0 0 3 0 33 0 311 10 0 321321 0 0 0 0 00 324324 8:15AM 0 0 0 0 00 0 0 6 0 66 0 319 8 0 327327 0 0 0 0 00 333333 TotalTotal 0 0 0 0 00 0 0 16 0 1616 0 1359 29 0 13881388 0 0 0 0 00 14041404 % Approach% Approach 0% 0% 0% 0% --0% 0% 100% 0% --0% 97.9% 2.1% 0% --0% 0% 0% 0% --- % Total% Total 0% 0% 0% 0% 0%0%0% 0% 1.1% 0% 1.1%1.1%0% 96.8% 2.1% 0% 98.9%98.9%0% 0% 0% 0% 0%0%- PHFPHF - - - - --- - 0.667 - 0.6670.667 - 0.871 0.725 - 0.8740.874 - - - - --0.878 LightsLights 0 0 0 0 00 0 0 15 0 1515 0 1327 29 0 13561356 0 0 0 0 00 1371 % Lights% Lights 0% 0% 0% 0% --0% 0% 93.8% 0% 93.8%93.8%0% 97.6% 100% 0% 97.7%97.7%0% 0% 0% 0% --97.6% Articulated TrucksArticulated Trucks 0 0 0 0 00 0 0 0 0 00 0 5 0 0 55 0 0 0 0 00 5 % Articulated Trucks% Articulated Trucks 0% 0% 0% 0% --0% 0% 0% 0% 0%0%0% 0.4% 0% 0% 0.4%0.4%0% 0% 0% 0% --0.4% Buses and Single-Unit TrucksBuses and Single-Unit Trucks 0 0 0 0 00 0 0 1 0 11 0 27 0 0 2727 0 0 0 0 00 28 % Buses and Single-Unit Trucks% Buses and Single-Unit Trucks 0% 0% 0% 0% --0% 0% 6.3% 0% 6.3%6.3%0% 2.0% 0% 0% 1.9%1.9%0% 0% 0% 0% --2.0% *L: Left, R: Right, T: Thru, U: U-Turn RANDOL_MILL @@ SSEECCOONNDD DDWWYY FFRROOMM NN -- TTMMCCThu Mar 23, 2023 Midday Peak (12:30 PM - 1:30 PM) - Overall Peak Hour All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1049338, Location: 32.936627, -97.185676 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg West SECOND DWY FROM N DAVIS BLVD DAVIS BLVD Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-03-23 12:30PM 0 0 0 0 00 0 0 12 0 1212 0 220 2 0 222222 0 224 8 0 232232 466466 12:45PM 0 0 0 0 00 0 0 16 0 1616 0 275 12 0 287287 0 219 5 0 224224 527527 1:00PM 0 0 0 0 00 0 0 18 0 1818 0 214 13 0 227227 0 235 4 0 239239 484484 1:15PM 0 0 0 0 00 0 0 22 0 2222 0 238 12 0 250250 0 246 13 0 259259 531531 TotalTotal 0 0 0 0 00 0 0 68 0 6868 0 947 39 0 986986 0 924 30 0 954954 20082008 % Approach% Approach 0% 0% 0% 0% --0% 0% 100% 0% --0% 96.0% 4.0% 0% --0% 96.9% 3.1% 0% --- % Total% Total 0% 0% 0% 0% 0%0%0% 0% 3.4% 0% 3.4%3.4%0% 47.2% 1.9% 0% 49.1%49.1%0% 46.0% 1.5% 0% 47.5%47.5%- PHFPHF - - - - --- - 0.773 - 0.7730.773 - 0.861 0.750 - 0.8590.859 - 0.939 0.577 - 0.9210.921 0.945 LightsLights 0 0 0 0 00 0 0 68 0 6868 0 928 38 0 966966 0 911 30 0 941941 1975 % Lights% Lights 0% 0% 0% 0% --0%0% 100% 0% 100%100%0% 98.0% 97.4% 0% 98.0%98.0%0% 98.6% 100% 0% 98.6%98.6%98.4% Articulated TrucksArticulated Trucks 0 0 0 0 00 0 0 0 0 00 0 4 0 0 44 0 2 0 0 22 6 % Articulated Trucks% Articulated Trucks 0% 0% 0% 0% --0% 0% 0% 0% 0%0%0% 0.4% 0% 0% 0.4%0.4%0% 0.2% 0% 0% 0.2%0.2%0.3% Buses and Single-Unit TrucksBuses and Single-Unit Trucks 0 0 0 0 00 0 0 0 0 00 0 15 1 0 1616 0 11 0 0 1111 27 % Buses and Single-Unit Trucks% Buses and Single-Unit Trucks 0% 0% 0% 0% --0% 0% 0% 0% 0%0%0% 1.6% 2.6% 0% 1.6%1.6%0% 1.2% 0% 0% 1.2%1.2%1.3% *L: Left, R: Right, T: Thru, U: U-Turn RANDOL_MILL @@ SSEECCOONNDD DDWWYY FFRROOMM NN -- TTMMCCThu Feb 16, 2023 PM Peak (4:45 PM - 5:45 PM) All Classes (Lights, Articulated Trucks, Buses and Single-Unit Trucks) All Movements ID: 1039821, Location: 32.936627, -97.185676 Provided by: GRAM Traffic NTX Inc. 1120 W. Lovers Lane, Arlington, TX, 76013, US Leg COMMERCIAL DWY N SECOND DWY DAVIS BLVD DAVIS BLVD Direction Eastbound Westbound Northbound Southbound Time L T R U AppApp L T R U AppApp L T R U AppApp L T R U AppApp IntInt 2023-02-16 4:45PM 0 0 0 0 00 0 0 16 0 1616 0 277 8 0 285285 0 0 0 0 00 301301 5:00PM 0 0 0 0 00 0 0 19 0 1919 0 277 13 0 290290 0 0 0 0 00 309309 5:15PM 0 0 0 0 00 0 0 22 0 2222 0 311 17 0 328328 0 0 0 0 00 350350 5:30PM 0 0 0 1 11 0 0 27 0 2727 0 275 7 0 282282 0 0 0 0 00 310310 TotalTotal 0 0 0 1 11 0 0 84 0 8484 0 1140 45 0 11851185 0 0 0 0 00 12701270 % Approach% Approach 0% 0% 0% 100% --0% 0% 100% 0% --0% 96.2% 3.8% 0% --0% 0% 0% 0% --- % Total% Total 0% 0% 0% 0.1% 0.1%0.1%0% 0% 6.6% 0% 6.6%6.6%0% 89.8% 3.5% 0% 93.3%93.3%0% 0% 0% 0% 0%0%- PHFPHF - - - 0.250 0.2500.250 - - 0.778 - 0.7780.778 - 0.916 0.662 - 0.9030.903 - - - - --0.907 LightsLights 0 0 0 1 11 0 0 84 0 8484 0 1131 45 0 11761176 0 0 0 0 00 1261 % Lights% Lights 0% 0% 0% 100% 100%100%0% 0% 100% 0% 100%100%0% 99.2% 100% 0% 99.2%99.2%0% 0% 0% 0% --99.3% Articulated TrucksArticulated Trucks 0 0 0 0 00 0 0 0 0 00 0 1 0 0 11 0 0 0 0 00 1 % Articulated Trucks% Articulated Trucks 0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%0% 0.1% 0% 0% 0.1%0.1%0% 0% 0% 0% --0.1% Buses and Single-Unit TrucksBuses and Single-Unit Trucks 0 0 0 0 00 0 0 0 0 00 0 8 0 0 88 0 0 0 0 00 8 % Buses and Single-Unit Trucks% Buses and Single-Unit Trucks 0% 0% 0% 0% 0%0%0% 0% 0% 0% 0%0%0% 0.7% 0% 0% 0.7%0.7%0% 0% 0% 0% --0.6% *L: Left, R: Right, T: Thru, U: U-Turn Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 67 Appendix D – Distribution Tables & Calculations for Background 2024 & Buildout 2024 Traffic Conditions Intersection #: 1 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right Start Time PHF AM 7 159 1,641 155 1 209 430 107 10 146 686 549 2 277 388 75 7:15 AM 0.960 MID 17 376 908 176 42 151 796 176 7 175 381 158 36 244 363 350 12:30 PM 0.940 PM 20 155 915 198 0 486 1,457 201 44 253 499 361 1 243 856 216 4:30 PM 0.959 Heavy Veh %: AM 2% 2% 2% 3% 2% 2% 4% 2% 10% 3% 2% 3% 2% 2% 2% 4% Heavy Veh %: MID 2% 2% 2% 2% 2% 4% 3% 3% 2% 2% 2% 2% 2% 3% 3% 3% Heavy Veh %: PM 2% 2% 2% 2% 2% 2% 2% 2% 2% 2% 2% 2% 2% 2% 2% 2% Approach Vol AM Approach Vol MID Approach Vol PM Departure Vol AM Departure Vol MID Departure Vol PM Link Total AM Link Total MID Link Total PM 2023 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right 2024 AM 8 163 1,674 159 2 214 439 110 11 149 700 560 3 283 396 77 2.0% MID 18 384 927 180 43 155 812 180 8 179 389 162 37 249 371 357 1.02 PM 21 159 934 202 0 496 1,487 206 45 259 509 369 2 248 874 221 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right AM MID PM U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right Enter Dist.: AM Trips: Enter Dist.: MID Trips: Enter Dist.: PM Trips: Exit Dist.: AM Trips: Exit Dist.: MID Trips: Exit Dist.: PM Trips: U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 MID 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right Start Time PHF AM 8 163 1,674 159 2 214 439 110 11 149 700 560 3 283 396 77 7:15 AM 0.960 MID 18 384 927 180 43 155 812 180 8 179 389 162 37 249 371 357 12:30 PM 0.940 PM 21 159 934 202 0 496 1,487 206 45 259 509 369 2 248 874 221 4:30 PM 0.959 Approach Vol AM Approach Vol MID Approach Vol PM Departure Vol AM Departure Vol MID Departure Vol PM Link Total AM Link Total MID Link Total PM 3,304 3,740 2,799 2,221 Estimated Link ADT: 33,040 37,400 27,990 22,210 2,677 3,284 2,200 1,735 2,875 2,571 1,452 2,004 1,366 1,381 714 990 1,988 1,551 1,617 876 673 2,519 780 976 2,004 765 1,420 759 1,509 1,190 738 1,014 Background Traffic Condition Southlake Blvd (FM 1709) Randol Mill Ave (FM 1938) EB WB NB SB 1,316 2,189 1,182 1,345 Trip Generation Data Background Land Use 1 EB WB NB SB Growth Rate: Factor: Background Traffic Reassignment 1 EB WB NB SB EB WB NB SB Traffic Count Year: Background Year: Growth of Existing Traffic to Background Year 856 658 2,468 762 954 1,477 1,165 721 993 Estimated Link ADT: 32,340 36,630 27,410 21,720 2,620 3,215 2,153 1,696 2,815 2,517 1,418 1,962 3,234 3,663 2,741 2,172 1,946 1,519 1,584 Collected Traffic Count Data Southlake Blvd (FM 1709) Randol Mill Ave (FM 1938) EB WB NB SB 1,338 1,352 697 969 1,288 2,144 1,157 1,316 1,962 747 1,391 742 Intersection #:1 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right Start Time PHF AM 8 163 1,674 159 2 214 439 110 11 149 700 560 3 283 396 77 7:15 AM 0.960 MID 18 384 927 180 43 155 812 180 8 179 389 162 37 249 371 357 12:30 PM 0.940 PM 21 159 934 202 0 496 1,487 206 45 259 509 369 2 248 874 221 4:30 PM 0.959 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right AM MID PM U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right Enter Dist.: AM 30% 20%Trips:27 Enter Dist.: MID 30% 20%Trips:31 Enter Dist.: PM 30% 20%Trips:19 Exit Dist.: AM 20% 30% 20%Trips:27 Exit Dist.: MID 20% 30% 20%Trips:31 Exit Dist.: PM 20% 30% 20%Trips:17 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right AM 0 0 9 0 0 0 0 0 6 9 6 0 0 6 0 0 MID 0 0 10 0 0 0 0 0 7 10 7 0 0 7 0 0 PM 0 0 6 0 0 0 0 0 4 6 4 0 0 4 0 0 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right Enter Dist.: AM -30% 20% -20%Trips:28 Enter Dist.: MID -30% 20% -20%Trips:32 Enter Dist.: PM -30% 20% -20%Trips:23 Exit Dist.: AM 20% 30%Trips:26 Exit Dist.: MID 20% 30%Trips:30 Exit Dist.: PM 20% 30%Trips:21 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right AM 0 0 0 0 0 0 -9 0 6 8 0 0 0 6 -6 0 MID 0 0 0 0 0 0 -10 0 6 9 0 0 0 7 -7 0 PM 0 0 0 0 0 0 -7 0 5 7 0 0 0 5 -5 0 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right AM 0 0 9 0 0 0 -9 0 12 17 6 0 0 12 -6 0 MID 0 0 10 0 0 0 -10 0 13 19 7 0 0 14 -7 0 PM 0 0 6 0 0 0 -7 0 9 13 4 0 0 9 -5 0 U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right U-Turn Left Thru Right Start Time PHF AM 8 163 1,683 159 2 214 430 110 23 166 706 560 3 295 390 77 7:15 AM 0.960 MID 18 384 937 180 43 155 802 180 21 198 396 162 37 263 364 357 12:30 PM 0.940 PM 21 159 940 202 0 496 1,480 206 54 272 513 369 2 257 869 221 4:30 PM 0.959 Approach Vol AM Approach Vol MID Approach Vol PM Departure Vol AM Departure Vol MID Departure Vol PM Link Total AM Link Total MID Link Total PM 3,316 3,748 2,829 2,229 Estimated Link ADT: 33,160 37,480 28,290 22,290 2,694 3,296 2,241 1,747 2,894 2,585 1,497 2,018 1,375 1,405 720 997 1,994 1,566 1,621 880 EB WB NB SB 1,322 2,182 1,208 1,349 681 2,540 786 982 2,013 756 1,455 765 1,519 1,180 777 1,021 Total Site Traffic Southlake Blvd (FM 1709) Randol Mill Ave (FM 1938) EB WB NB SB Buildout - Total Traffic Condition Southlake Blvd (FM 1709) Randol Mill Ave (FM 1938) Primary Trips Associated with Proposed Development EB WB NB SB EB WB NB SB Trip Generation Data Trip Generation Data Pass-By / Diverted Trips Associated with Proposed Development EB WB NB SB Continued Total Background Traffic Southlake Blvd (FM 1709) Randol Mill Ave (FM 1938) EB WB NB SB Traffic Reassignment for Driveway Consolidation Intersection #: 2 Left Thru Right Left Thru Right Left Thru Right Left Thru Right Start Time PHF AM 2,499 13 747 88 7:15 AM 0.948 MID 1,320 20 1,165 51 12:30 AM 0.943 PM 1,471 13 2,144 44 4:30 PM 0.976 Heavy Veh %: AM 2% 2% 3% 2% Heavy Veh %: MID 3% 2% 2% 2% Heavy Veh %: PM 2% 2% 2% 2% Approach Vol AM Approach Vol MID Approach Vol PM Departure Vol AM Departure Vol MID Departure Vol PM Link Total AM Link Total MID Link Total PM 2023 Left Thru Right Left Thru Right Left Thru Right Left Thru Right 2024 AM 0 2,549 14 0 762 0 0 0 90 0 0 0 2.0% MID 0 1,347 21 0 1,189 0 0 0 53 0 0 0 1.02 PM 0 1,501 14 0 2,187 0 0 0 45 0 0 0 Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM MID PM Left Thru Right Left Thru Right Left Thru Right Left Thru Right Enter Dist.:AM Trips: Enter Dist.:MID Trips: Enter Dist.:PM Trips: Exit Dist.:AM Trips: Exit Dist.:MID Trips: Exit Dist.:PM Trips: Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM 0 0 0 0 0 0 0 0 0 0 0 0 MID 0 0 0 0 0 0 0 0 0 0 0 0 PM 0 0 0 0 0 0 0 0 0 0 0 0 Left Thru Right Left Thru Right Left Thru Right Left Thru Right Start Time PHF AM 0 2,549 14 0 762 0 0 0 90 0 0 0 7:15 AM 0.948 MID 0 1,347 21 0 1,189 0 0 0 53 0 0 0 12:30 AM 0.943 PM 0 1,501 14 0 2,187 0 0 0 45 0 0 0 4:30 PM 0.976 Approach Vol AM Approach Vol MID Approach Vol PM Departure Vol AM Departure Vol MID Departure Vol PM Link Total AM Link Total MID Link Total PM Collected Traffic Count Data Southlake Blvd (FM 1709) Access Point 1 (2nd Driveway West) EB WB NB SB 1,484 2,144 44 0 747 2,587 13 0 2,512 747 88 0 1,340 1,165 51 0 3,259 3,334 101 0 2,505 2,536 71 0 1,165 1,371 20 0 2,144 1,515 13 0 3,628 3,659 57 0 Estimated Link ADT: 36,280 36,590 1,010 0 EB WB NB SB Traffic Count Year: Background Year: Growth of Existing Traffic to Background Year Growth Rate: Factor: Background Traffic Reassignment 1 EB WB NB SB Background Land Use 1 EB WB NB SB Trip Generation Data Background Traffic Condition Southlake Blvd (FM 1709) Access Point 1 (2nd Driveway West) EB WB NB SB 1,515 2,187 45 0 762 2,639 14 0 2,563 762 90 0 1,368 1,189 53 0 3,325 3,401 104 0 2,557 2,589 74 0 1,189 1,400 21 0 2,187 1,546 14 0 3,702 3,733 59 0 Estimated Link ADT: 37,020 37,330 1,040 0 Intersection #:2 Left Thru Right Left Thru Right Left Thru Right Left Thru Right Start Time PHF AM 0 2,549 14 0 762 0 0 0 90 0 0 0 7:15 AM 0.948 MID 0 1,347 21 0 1,189 0 0 0 53 0 0 0 12:30 AM 0.943 PM 0 1,501 14 0 2,187 0 0 0 45 0 0 0 4:30 PM 0.976 Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM MID PM Left Thru Right Left Thru Right Left Thru Right Left Thru Right Enter Dist.:AM 50%Trips:27 Enter Dist.:MID 50%Trips:31 Enter Dist.:PM 50%Trips:19 Exit Dist.:AM 30%Trips:27 Exit Dist.:MID 30%Trips:31 Exit Dist.:PM 30%Trips:17 Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM 0 0 14 0 0 0 0 0 9 0 0 0 MID 0 0 16 0 0 0 0 0 10 0 0 0 PM 0 0 10 0 0 0 0 0 6 0 0 0 Left Thru Right Left Thru Right Left Thru Right Left Thru Right Enter Dist.:AM -30%50%-30%Trips:28 Enter Dist.:MID -30%50%-30%Trips:32 Enter Dist.:PM -30%50%-30%Trips:23 Exit Dist.:AM 30%Trips:26 Exit Dist.:MID 30%Trips:30 Exit Dist.:PM 30%Trips:21 Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM 0 -9 14 0 -9 0 0 0 8 0 0 0 MID 0 -10 16 0 -10 0 0 0 9 0 0 0 PM 0 -7 12 0 -7 0 0 0 7 0 0 0 Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM 0 -9 28 0 -9 0 0 0 17 0 0 0 MID 0 -10 32 0 -10 0 0 0 19 0 0 0 PM 0 -7 22 0 -7 0 0 0 13 0 0 0 Left Thru Right Left Thru Right Left Thru Right Left Thru Right Start Time PHF AM 0 2,540 42 0 753 0 0 0 107 0 0 0 7:15 AM 0.948 MID 0 1,337 53 0 1,179 0 0 0 72 0 0 0 12:30 AM 0.943 PM 0 1,494 36 0 2,180 0 0 0 58 0 0 0 4:30 PM 0.976 Approach Vol AM Approach Vol MID Approach Vol PM Departure Vol AM Departure Vol MID Departure Vol PM Link Total AM Link Total MID Link Total PM Traffic Reassignment for Driveway Consolidation EB WB NB SB Continued Total Background Traffic Southlake Blvd (FM 1709) Access Point 1 (2nd Driveway West) EB WB NB SB Trip Generation Data Pass-By / Diverted Trips Associated with Proposed Development EB WB NB SB Primary Trips Associated with Proposed Development EB WB NB SB Buildout - Total Traffic Condition Southlake Blvd (FM 1709) Access Point 1 (2nd Driveway West) EB WB NB SB Trip Generation Data Total Site Traffic Southlake Blvd (FM 1709) Access Point 1 (2nd Driveway West) EB WB NB SB 1,530 2,180 58 0 753 2,647 42 0 2,582 753 107 0 1,390 1,179 72 0 3,335 3,400 149 0 2,569 2,588 125 0 1,179 1,409 53 0 2,180 1,552 36 0 3,710 3,732 94 0 Estimated Link ADT: 37,100 37,320 1,490 0 Intersection #: 3 Left Thru Right Left Thru Right Left Thru Right Left Thru Right Start Time PHF AM 16 1,359 29 762 7:30 AM 0.878 MID 68 947 39 697 12:30 PM 0.945 PM 84 1,140 45 1,584 4:45 PM 0.907 Heavy Veh %: AM 7% 3% 2% 2% Heavy Veh %: MID 2% 2% 3% 2% Heavy Veh %: PM 2% 2% 2% 2% Approach Vol AM Approach Vol MID Approach Vol PM Departure Vol AM Departure Vol MID Departure Vol PM Link Total AM Link Total MID Link Total PM 2023 Left Thru Right Left Thru Right Left Thru Right Left Thru Right 2024 AM 0 0 0 0 0 17 0 1,387 30 0 778 0 2.0% MID 0 0 0 0 0 70 0 966 40 0 711 0 1.02 PM 0 0 0 0 0 86 0 1,163 46 0 1,616 0 Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM MID PM Left Thru Right Left Thru Right Left Thru Right Left Thru Right Enter Dist.:AM Trips: Enter Dist.:MID Trips: Enter Dist.:PM Trips: Exit Dist.:AM Trips: Exit Dist.:MID Trips: Exit Dist.:PM Trips: Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM 0 0 0 0 0 0 0 0 0 0 0 0 MID 0 0 0 0 0 0 0 0 0 0 0 0 PM 0 0 0 0 0 0 0 0 0 0 0 0 Left Thru Right Left Thru Right Left Thru Right Left Thru Right Start Time PHF AM 0 0 0 0 0 17 0 1,387 30 0 778 0 7:30 AM 0.878 MID 0 0 0 0 0 70 0 966 40 0 711 0 12:30 PM 0.945 PM 0 0 0 0 0 86 0 1,163 46 0 1,616 0 4:45 PM 0.907 Approach Vol AM Approach Vol MID Approach Vol PM Departure Vol AM Departure Vol MID Departure Vol PM Link Total AM Link Total MID Link Total PM Collected Traffic Count Data Access Point 2 (2nd Driveway South) Randol Mill Ave (FM 1938) EB WB NB SB 0 84 1,185 1,584 0 29 762 1,375 0 16 1,388 762 0 68 986 697 0 45 2,150 2,137 0 107 1,683 1,712 0 39 697 1,015 0 45 1,584 1,224 0 129 2,769 2,808 Estimated Link ADT: 0 1,290 27,690 28,080 EB WB NB SB Traffic Count Year: Background Year: Growth of Existing Traffic to Background Year Growth Rate: Factor: Background Traffic Reassignment 1 EB WB NB SB Background Land Use 1 EB WB NB SB Trip Generation Data Background Traffic Condition Access Point 2 (2nd Driveway South) Randol Mill Ave (FM 1938) EB WB NB SB 0 86 1,209 1,616 0 30 778 1,404 0 17 1,417 778 0 70 1,006 711 0 47 2,195 2,182 0 110 1,717 1,747 0 40 711 1,036 0 46 1,616 1,249 0 132 2,825 2,865 Estimated Link ADT: 0 1,320 28,250 28,650 Intersection #:3 Left Thru Right Left Thru Right Left Thru Right Left Thru Right Start Time PHF AM 0 0 0 0 0 17 0 1,387 30 0 778 0 7:30 AM 0.878 MID 0 0 0 0 0 70 0 966 40 0 711 0 12:30 PM 0.945 PM 0 0 0 0 0 86 0 1,163 46 0 1,616 0 4:45 PM 0.907 Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM MID PM Left Thru Right Left Thru Right Left Thru Right Left Thru Right Enter Dist.:AM 20%Trips:27 Enter Dist.:MID 20%Trips:31 Enter Dist.:PM 20%Trips:19 Exit Dist.:AM 70%20%Trips:27 Exit Dist.:MID 70%20%Trips:31 Exit Dist.:PM 70%20%Trips:17 Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM 0 0 0 0 0 19 0 0 6 0 6 0 MID 0 0 0 0 0 22 0 0 7 0 7 0 PM 0 0 0 0 0 12 0 0 4 0 4 0 Left Thru Right Left Thru Right Left Thru Right Left Thru Right Enter Dist.:AM -20%20%Trips:28 Enter Dist.:MID -20%20%Trips:32 Enter Dist.:PM -20%20%Trips:23 Exit Dist.:AM 70%Trips:26 Exit Dist.:MID 70%Trips:30 Exit Dist.:PM 70%Trips:21 Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM 0 0 0 0 0 19 0 -6 6 0 0 0 MID 0 0 0 0 0 21 0 -7 7 0 0 0 PM 0 0 0 0 0 15 0 -5 5 0 0 0 Left Thru Right Left Thru Right Left Thru Right Left Thru Right AM 0 0 0 0 0 38 0 -6 12 0 6 0 MID 0 0 0 0 0 43 0 -7 14 0 7 0 PM 0 0 0 0 0 27 0 -5 9 0 4 0 Left Thru Right Left Thru Right Left Thru Right Left Thru Right Start Time PHF AM 0 0 0 0 0 55 0 1,381 42 0 784 0 7:30 AM 0.878 MID 0 0 0 0 0 113 0 959 54 0 718 0 12:30 PM 0.945 PM 0 0 0 0 0 113 0 1,158 55 0 1,620 0 4:45 PM 0.907 Approach Vol AM Approach Vol MID Approach Vol PM Departure Vol AM Departure Vol MID Departure Vol PM Link Total AM Link Total MID Link Total PM Traffic Reassignment for Driveway Consolidation EB WB NB SB Continued Total Background Traffic Access Point 2 (2nd Driveway South) Randol Mill Ave (FM 1938) EB WB NB SB Trip Generation Data Pass-By / Diverted Trips Associated with Proposed Development EB WB NB SB Primary Trips Associated with Proposed Development EB WB NB SB Buildout - Total Traffic Condition Access Point 2 (2nd Driveway South) Randol Mill Ave (FM 1938) EB WB NB SB Trip Generation Data Total Site Traffic Access Point 2 (2nd Driveway South) Randol Mill Ave (FM 1938) EB WB NB SB 0 113 1,213 1,620 0 42 784 1,436 0 55 1,423 784 0 113 1,013 718 0 97 2,207 2,220 0 167 1,731 1,790 0 54 718 1,072 0 55 1,620 1,271 0 168 2,833 2,891 Estimated Link ADT: 0 1,680 28,330 28,910 Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 74 Appendix E – Existing Traffic Signal Timing Plans 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 1/17 All Data Report #2 Date/Time: 2023-03-22 11:36:12.746225 Intersection Name: FM1709@ FM1938(04-2022) Intersection Alias: FM1709/F1938 Access Code Connection Method Revision Port 2 Baud Rate Address IP Address GPS Enabled GPS Port 9999 DatabaseOnly 5.2.2 6-38400 None None False 8 Access Data Port Configuration Scoot Default Data Spat Data VEHICLE AND PEDESTRIAN TIMES Phase Data Bank 1: Vehicle Basic Timings Misc Timings Pedestrian Timings Phase MinGreen Passage Max1 Max2 DMAX DSTP/10 Yel/10 Red/10 GreenDelay YellowDelay WalkOffsetTime WalkOffsetMode BikeGreen BikePsg Walk PedClr AltWalk AltPedClr FlashWalk ExtPedClr ActuatedRest inWalk 1 5 20 25 0 0 0 50 30 0 0 0 0 0 0 0 0 0 0 False 0 False 2 10 20 60 0 0 0 50 30 0 0 0 0 0 0 7 38 0 0 False 0 False 3 5 20 25 0 0 0 50 30 0 0 0 0 0 0 0 0 0 0 False 0 False 4 5 20 40 0 0 0 50 30 0 0 0 0 0 0 7 39 0 0 False 0 False 5 5 20 25 0 0 0 50 30 0 0 0 0 0 0 0 0 0 0 False 0 False 6 10 20 60 0 0 0 50 30 0 0 0 0 0 0 7 39 0 0 False 0 False 7 5 20 25 0 0 0 50 30 0 0 0 0 0 0 0 0 0 0 False 0 False 8 5 20 40 0 0 0 50 30 0 0 0 0 0 0 7 39 0 0 False 0 False Phase Data Bank 2: Vehicle Basic Timings Misc Timings Pedestrian Timings Phase MinGreen Passage Max1 Max2 DMAX DSTP/10 Yel/10 Red/10 GreenDelay YellowDelay WalkOffsetTime WalkOffsetMode BikeGreen BikePsg Walk PedClr AltWalk AltPedClr FlashWalk ExtPedClr ActuatedRest inWalk 1 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 2 10 20 60 0 0 0 45 30 0 0 0 0 0 0 7 37 0 0 False 0 False 3 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 4 5 20 40 0 0 0 45 30 0 0 0 0 0 0 7 39 0 0 False 0 False 5 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 6 10 20 60 0 0 0 45 30 0 0 0 0 0 0 7 37 0 0 False 0 False 7 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 8 5 20 40 0 0 0 45 30 0 0 0 0 0 0 7 38 0 0 False 0 False Phase Data Bank 3: Vehicle Basic Timings Misc Timings Pedestrian Timings Phase MinGreen Passage Max1 Max2 DMAX DSTP/10 Yel/10 Red/10 GreenDelay YellowDelay WalkOffsetTime WalkOffsetMode BikeGreen BikePsg Walk PedClr AltWalk AltPedClr FlashWalk ExtPedClr ActuatedRest inWalk 1 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 2 10 20 60 0 0 0 45 30 0 0 0 0 0 0 7 37 0 0 False 0 False Port Baud Rate Data Bits Parity CTS DCD RTS 2 5 0 0 False False False 3 5 0 0 False False False Default Data 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 2/17 3 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 4 5 20 40 0 0 0 45 30 0 0 0 0 0 0 7 39 0 0 False 0 False 5 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 6 10 20 60 0 0 0 45 30 0 0 0 0 0 0 7 37 0 0 False 0 False 7 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 8 5 20 40 0 0 0 45 30 0 0 0 0 0 0 7 38 0 0 False 0 False Phase Data Bank 4: Vehicle Basic Timings Misc Timings Pedestrian Timings Phase MinGreen Passage Max1 Max2 DMAX DSTP/10 Yel/10 Red/10 GreenDelay YellowDelay WalkOffsetTime WalkOffsetMode BikeGreen BikePsg Walk PedClr AltWalk AltPedClr FlashWalk ExtPedClr ActuatedRest inWalk 1 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 2 10 20 60 0 0 0 45 30 0 0 0 0 0 0 7 37 0 0 False 0 False 3 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 4 5 20 40 0 0 0 45 30 0 0 0 0 0 0 7 39 0 0 False 0 False 5 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 6 10 20 60 0 0 0 45 30 0 0 0 0 0 0 7 37 0 0 False 0 False 7 5 20 25 0 0 0 45 30 0 0 0 0 0 0 0 0 0 0 False 0 False 8 5 20 40 0 0 0 45 30 0 0 0 0 0 0 7 38 0 0 False 0 False DENSITY TIMES AND GENERAL/VEHICLE/SEQUENCE CONTROL Phase Data Bank 1: Vehicle Density Timings General Control Miscellaneous Special Sequence Phase AddedInitial MaxInitial TimeB4Redu CarB4Redu TimetoRedu MinGap Non-ActResponse VehRecall RecallDelay PedRecall PedRecallDelay NonLock DualEntry LastCarPass ConditService NoSimuGapOut Omit MinusYel OmitCall 2 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 4 0 0 0 0 0 0 False None 0 None 0 True True False False False 0 0 0 6 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 8 0 0 0 0 0 0 False None 0 None 0 True True False False False 0 0 0 Phase Data Bank 2: Vehicle Density Timings General Control Miscellaneous Special Sequence Phase AddedInitial MaxInitial TimeB4Redu CarB4Redu TimetoRedu MinGap Non-ActResponse VehRecall RecallDelay PedRecall PedRecallDelay NonLock DualEntry LastCarPass ConditService NoSimuGapOut Omit MinusYel OmitCall 2 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 4 0 0 0 0 0 0 False None 0 None 0 True True False False False 0 0 0 6 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 8 0 0 0 0 0 0 False None 0 None 0 True True False False False 0 0 0 Phase Data Bank 3: Vehicle Density Timings General Control Miscellaneous Special Sequence Phase AddedInitial MaxInitial TimeB4Redu CarB4Redu TimetoRedu MinGap Non-ActResponse VehRecall RecallDelay PedRecall PedRecallDelay NonLock DualEntry LastCarPass ConditService NoSimuGapOut Omit MinusYel OmitCall 2 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 4 0 0 0 0 0 0 False None 0 None 0 True True False False False 0 0 0 6 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 8 0 0 0 0 0 0 False None 0 None 0 True True False False False 0 0 0 Phase Data Bank 4: Vehicle Density Timings General Control Miscellaneous Special Sequence 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 3/17 Phase AddedInitial MaxInitial TimeB4Redu CarB4Redu TimetoRedu MinGap Non-ActResponse VehRecall RecallDelay PedRecall PedRecallDelay NonLock DualEntry LastCarPass ConditService NoSimuGapOut Omit MinusYel OmitCall 2 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 4 0 0 0 0 0 0 False None 0 None 0 True True False False False 0 0 0 6 0 0 0 0 0 0 True Min 0 None 0 False True False False False 0 0 0 8 0 0 0 0 0 0 False None 0 None 0 True True False False False 0 0 0 Detector Bank: 1 Detector Bank: 2 Detector Bank: 3 Detector Bank: 4 Startup & Misc Vehicle Detector Pedestrian Detector Special Detector VehDet AssignPhase Mode SwitchPhase Extend Delay 7 7 0 0 0.0 0 8 8 0 0 0.0 0 9 1 0 0 0.0 0 10 2 0 0 0.0 0 11 3 0 0 0.0 0 12 4 0 0 0.0 0 13 5 0 0 0.0 0 14 6 0 0 0.0 0 15 7 0 0 0.0 0 6 6 0 0 0.0 0 5 5 0 0 0.0 0 4 4 0 0 0.0 0 3 3 0 0 0.0 0 2 2 0 0 0.0 0 1 1 0 0 0.0 0 16 8 0 0 0.0 0 18 2 0 0 0.0 0 20 4 0 0 0.0 0 22 6 0 0 0.0 0 24 8 0 0 0.0 0 26 2 0 0 0.0 0 28 4 0 0 0.0 0 30 6 0 0 0.0 0 32 8 0 0 0.0 0 Vehicle Detector Phase Assignment PedDet AssignPhase Mode SwitchPhase Extend Delay 1 1 1 0 0.0 0 2 2 1 0 0.0 0 3 3 1 0 0.0 0 4 4 1 0 0.0 0 5 5 1 0 0.0 0 6 6 1 0 0.0 0 7 7 1 0 0.0 0 8 8 1 0 0.0 0 Pedestrian Detector SpcDet AssignPhase Mode SwitchPhase Extend Delay Special Detector Phase Assignment VehDet AssignPhase Mode SwitchPhase Extend Delay Vehicle Detector Phase Assignment PedDet AssignPhase Mode SwitchPhase Extend Delay Pedestrian Detector SpcDet AssignPhase Mode SwitchPhase Extend Delay Special Detector Phase Assignment VehDet AssignPhase Mode SwitchPhase Extend Delay Vehicle Detector Phase Assignment PedDet AssignPhase Mode SwitchPhase Extend Delay Pedestrian Detector SpcDet AssignPhase Mode SwitchPhase Extend Delay Special Detector Phase Assignment VehDet AssignPhase Mode SwitchPhase Extend Delay Vehicle Detector Phase Assignment PedDet AssignPhase Mode SwitchPhase Extend Delay Pedestrian Detector SpcDet AssignPhase Mode SwitchPhase Extend Delay Special Detector Phase Assignment Startup Time 7 Time In Seconds 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 4/17 Remote Flash Overlap Special Ring Output Mapping Configuration Load Switch Red Mode Yellow Mode Green Mode FIO 25 None None None None None None 25 26 None None None None None None 26 27 None None None None None None 27 28 None None None None None None 28 Startup State All Red Red Revert 40.0 Time in Tenth Second Auto Pedestrian Clear 0 0-No 1-Yes Stop Time Reset 0 0-No 1-Yes Alternate Sequence 1 00-18 Alt Sequence ## Special Sequence 0 LoadSwitch Flash Alt 1 Red 0 2 Red 1 3 Red 0 4 Red 1 5 Red 0 6 Red 1 7 Red 1 8 Red 1 13 Red 1 14 Red 1 15 Red 1 16 Red 1 Remote Flash Phase Entry Exit 2 True True 6 True True Flash Entry/Exit Phases Standard FYA Overlap Parents Trail Grn/ 10 Trail Yel/ 10 Trail Red/ 10 Trail GrnPreempt +GrnPhases -G/YPhases -PedPhases A 2 0 45 30 0 None None None B 4 0 45 30 0 None None None C 6 0 45 30 0 None None None D 8 0 45 30 0 None None None Standard Default Data FYA PED PRI Default Data PED Default Data PRI Phase Ring Next Phase Concur Phases 1 1 2 1, 6 2 1 3 2, 5, 6 3 1 4 3, 7, 8 4 1 1 4, 7, 8 5 2 6 2, 5 6 2 7 1, 2, 6 7 2 8 3, 4, 7 8 2 5 3, 4, 8 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 5/17 29 None None None None None None 29 24 None None None None None None 24 23 None None None None None None 23 22 None None None None None None 22 21 None None None None None None 21 20 Phase Pedestrian 7 Dont Walk Phase Pedestrian 7 Ped Clear Phase Pedestrian 7 Walk 20 19 Phase Pedestrian 5 Dont Walk Phase Pedestrian 5 Ped Clear Phase Pedestrian 5 Walk 19 18 Phase Pedestrian 3 Dont Walk Phase Pedestrian 3 Ped Clear Phase Pedestrian 3 Walk 18 17 Phase Pedestrian 1 Dont Walk Phase Pedestrian 1 Ped Clear Phase Pedestrian 1 Walk 17 16 Overlap D Red Overlap D Yellow Overlap D Green 16 15 Overlap C Red Overlap C Yellow Overlap C Green 15 14 Overlap B Red Overlap B Yellow Overlap B Green 14 13 Overlap A Red Overlap A Yellow Overlap A Green 13 12 Phase Pedestrian 8 Dont Walk Phase Pedestrian 8 Ped Clear Phase Pedestrian 8 Walk 12 11 Phase Pedestrian 6 Dont Walk Phase Pedestrian 6 Ped Clear Phase Pedestrian 6 Walk 11 10 Phase Pedestrian 4 Dont Walk Phase Pedestrian 4 Ped Clear Phase Pedestrian 4 Walk 10 9 Phase Pedestrian 2 Dont Walk Phase Pedestrian 2 Ped Clear Phase Pedestrian 2 Walk 9 8 Phase Vehicle 8 Red Phase Vehicle 8 Yellow Phase Vehicle 8 Green 8 7 Phase Vehicle 7 Red Phase Vehicle 7 Yellow Phase Vehicle 7 Green 7 6 Phase Vehicle 6 Red Phase Vehicle 6 Yellow Phase Vehicle 6 Green 6 5 Phase Vehicle 5 Red Phase Vehicle 5 Yellow Phase Vehicle 5 Green 5 4 Phase Vehicle 4 Red Phase Vehicle 4 Yellow Phase Vehicle 4 Green 4 3 Phase Vehicle 3 Red Phase Vehicle 3 Yellow Phase Vehicle 3 Green 3 2 Phase Vehicle 2 Red Phase Vehicle 2 Yellow Phase Vehicle 2 Green 2 1 Phase Vehicle 1 Red Phase Vehicle 1 Yellow Phase Vehicle 1 Green 1 30 None None None None None None 30 31 None None None None None None 31 32 None None None None None None 32 Sequence Data Sequence 1 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 6 7 8 5 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 1 Sequence 2 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 5 6 8 7 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 2 Sequence 3 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 6/17 1 1 2 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 6 5 7 8 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 3 Sequence 4 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 7 8 6 5 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 4 Sequence 5 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 7 8 6 5 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 5 Sequence 6 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 7 8 5 6 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 6 Sequence 7 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 7 8 6 5 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 7 Sequence 8 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 7 8 5 6 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 8 Sequence 9 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 7/17 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 8 7 6 5 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 9 Sequence 10 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 7 8 6 5 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 10 Sequence 11 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 8 7 6 5 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 11 Sequence 12 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 7 8 6 5 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 12 Sequence 13 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 7 8 6 5 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 13 Sequence 14 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 8 7 5 6 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 14 Sequence 15 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 8/17 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 1 2 3 4 0 0 0 0 0 0 0 0 0 0 0 0 2 7 8 6 5 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 15 Sequence 16 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Ring 1 2 1 4 3 0 0 0 0 0 0 0 0 0 0 0 0 2 8 7 5 6 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Sequence 16 Port 1 and ITS Data Address Device Present Basic Detection Msg 40 Frame Enables 0 True False False 1 True False False 8 True False False 9 True False False 16 True False False 18 True False False I/O Misc ABC Input(Entry) Modes ABC Output(O/STS) Modes D Input(Entry) Modes D Output (O/STS) Modes Aux Switch 0 0 1 0 0 Ring Input Response Output Selection 1 1 1 2 2 2 3 0 0 4 0 0 Peer to Peer Unit Bank: 1 Default Data Unit Bank: 2 Default Data Unit Bank: 3 Default Data Unit Bank: 4 Default Data Coord Data Operation Mode Max Correction Offset Force Max Dwell Yield Period Manual Pattern Auto Perm Yield Inhibit Short Way Beg Green Plan 0 0 1 Coord Setup Pattern Data 1 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 1 130 0 0 0 0 0 0 52 2 0 0 0 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 9/17 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 21 53 21 35 19 55 20 36 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 4 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 4 120 0 0 0 0 0 0 79 3 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 24 53 21 22 23 54 17 26 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 7 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 7 150 0 0 0 0 0 0 48 3 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 35 54 23 38 23 66 20 41 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Pattern Data 10 Pattern Cycle Length Coord Mode Max Mode Corr Mode Coord Offset Force Mode Spec Func Time Offset Sequence R2 Lag R3 Lag R4 Lag 10 140 0 0 0 0 0 0 121 3 0 0 0 Phase 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Time 31 55 25 29 19 67 21 33 0 0 0 0 0 0 0 0 Mode None None None None None None None None None None None None None None None None Coord False True False False False True False False False False False False False False False False DCP False False False False False False False False False False False False False False False False P.RED.0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 P.EXT 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Time Based Control Data DST Cycle Zero: 1 day, 0:00 DST Type: 0 TimeZoneDiff: 0 EntryNumber BeginMonth BeginOccurrences Begin DayOf Week Begin Day OfMonth Begin Seconds ToTransition EndMonth EndOccurrences End Day OfWeek End Day OfMonth End Seconds ToTransition Seconds ToAdjust 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 10/17 1 3 2 1 1 7200 11 1 1 1 7200 3600 2 14 1 1 1 0 1 1 1 1 0 0 DST Schedules Month Day of Month Day of Week Schedule Plan 1 2 3 4 5 6 7 8 9 10 11 12 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 1 2 3 4 5 6 7 1 1 X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X 2 2 X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X X Schedules Day Plans Day Plan 1 Event Hour Minute Action 1 8 0 10 2 20 0 254 Day Plan 1 Day Plan 2 Event Hour Minute Action 1 6 0 1 2 10 0 4 3 15 15 7 4 19 0 254 Day Plan 2 Day Plan 3 Event Hour Minute Action 1 6 0 1 2 8 45 4 3 15 15 7 4 19 0 4 5 20 0 19 6 22 0 254 Day Plan 3 Day Plan 4 Event Hour Minute Action 1 6 0 1 2 8 45 4 3 15 15 7 4 19 0 4 5 20 0 19 6 22 0 254 Day Plan 4 Day Plan 5 Event Hour Minute Action 1 6 0 1 2 8 45 4 3 15 15 7 4 19 0 4 5 20 0 19 6 22 0 254 Day Plan 5 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 11/17 Actions Action Pattern Aux1 Aux2 Aux3 SP1 SP2 SP3 SP4 SP5 SP6 SP7 SP8 DIM Det1 Det2 Det3 Ph1 Ph2 Ph3 Ph4 Ph5 Ph6 Ph7 Ph8 Ph9 Ph10 Ph11 Ph12 Ph13 Ph14 Ph15 Ph16 1 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 3 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 7 7 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10 10 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11 11 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 13 13 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 19 19 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 22 22 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 25 25 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 37 37 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 254 254 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Actions Dimming Default Data Preempt Configuration Preempt Overrides Preempt Overrides 1 2 3 4 5 6 7 8 9 10 11 12 OV Flash 0 0 0 0 0 0 0 0 0 0 0 0 OV PE+1 0 0 0 0 0 0 0 0 0 0 0 0 OV PRI 0 0 0 0 0 0 0 0 0 0 0 0 Preempt Overrides Day Plan 6 Event Hour Minute Action 1 6 0 1 2 8 45 4 3 15 15 7 4 19 0 4 5 20 0 19 6 22 0 254 Day Plan 6 Day Plan 7 Event Hour Minute Action 1 7 0 19 2 9 0 10 3 20 0 19 4 22 0 254 Day Plan 7 Special Function Maps 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 SPC 1-8 AsPHS Func 1-8 1 1 1 1 0 0 0 0 0 0 0 0 0 0 0 0 Special Function Maps Phase Functions 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 Phase 1Overlap Omit 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Phase 2Overlap Omit 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Phase 3Overlap Omit 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 Phase 4Overlap Omit 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 Phase Functions 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 12/17 Preempt 1 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK# DURAT GATE R2C 248 0 120 0 0 0 0 0 0 0 0 0 Miscellaneous Interval Timings MINGRN MINWLK DWLGRN EXTPED SEL PEDCLR SELYEL/10 SELRED/10 TRKGRN TRK PEDCLR TRKYEL/10 TRKRED/10 RET PEDCLR RETYEL/10 RETRED/10 0 0 5 0 7 40 20 5 0 40 20 0 40 20 Interval Timings Preempt 2 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK# DURAT GATE R2C 249 0 120 0 0 0 0 0 0 0 0 0 Miscellaneous Interval Timings MINGRN MINWLK DWLGRN EXTPED SEL PEDCLR SELYEL/10 SELRED/10 TRKGRN TRK PEDCLR TRKYEL/10 TRKRED/10 RET PEDCLR RETYEL/10 RETRED/10 0 0 5 0 7 40 20 5 0 40 20 0 40 20 Interval Timings Exit/Calls Default Data Exit/Calls Vehicle Data Phase Track Green DWELL Cycle 3 1 1 0 8 1 1 0 Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data Overlap Data Phase TrackGreen DWELL Cycle Trail 1 0 0 0 0 2 0 0 0 0 3 0 0 0 0 4 1 1 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 16 0 0 0 0 Overlap Data Exit/Calls Default Data Exit/Calls Vehicle Data Phase Track Green DWELL Cycle 4 1 1 0 7 1 1 0 Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 Overlap Data Phase TrackGreen DWELL Cycle Trail 1 0 0 0 0 2 1 1 0 0 3 0 0 0 0 4 0 0 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 13/17 Preempt 3 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK# DURAT GATE R2C 250 0 120 0 0 0 0 0 0 0 0 0 Miscellaneous Interval Timings MINGRN MINWLK DWLGRN EXTPED SEL PEDCLR SELYEL/10 SELRED/10 TRKGRN TRK PEDCLR TRKYEL/10 TRKRED/10 RET PEDCLR RETYEL/10 RETRED/10 0 0 5 0 7 40 20 5 0 40 20 0 40 20 Interval Timings Preempt 4 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK# DURAT GATE R2C 251 0 120 0 0 0 0 0 0 0 0 0 Miscellaneous Interval Timings MINGRN MINWLK DWLGRN EXTPED SEL PEDCLR SELYEL/10 SELRED/10 TRKGRN TRK PEDCLR TRKYEL/10 TRKRED/10 RET PEDCLR RETYEL/10 RETRED/10 0 0 5 0 7 40 20 5 0 40 20 0 40 20 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 16 0 0 0 0 Overlap Data Exit/Calls Default Data Exit/Calls Vehicle Data Phase Track Green DWELL Cycle 2 1 1 0 5 1 1 0 Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data Overlap Data Phase TrackGreen DWELL Cycle Trail 1 1 1 0 0 2 0 0 0 0 3 0 0 0 0 4 0 0 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 16 0 0 0 0 Overlap Data 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 14/17 Interval Timings Preempt 5 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK# DURAT GATE R2C 252 0 0 0 0 0 0 0 0 0 0 0 Miscellaneous Interval Timings MINGRN MINWLK DWLGRN EXTPED SEL PEDCLR SELYEL/10 SELRED/10 TRKGRN TRK PEDCLR TRKYEL/10 TRKRED/10 RET PEDCLR RETYEL/10 RETRED/10 0 0 0 0 0 40 20 0 0 40 20 0 40 20 Interval Timings Exit/Calls Default Data Exit/Calls Vehicle Data Phase Track Green DWELL Cycle 1 1 1 0 6 1 1 0 Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data Overlap Data Phase TrackGreen DWELL Cycle Trail 1 0 0 0 0 2 0 0 0 0 3 1 1 0 0 4 0 0 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 16 0 0 0 0 Overlap Data Exit/Calls Default Data Exit/Calls Vehicle Data Default Data Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data Overlap Data Phase TrackGreen DWELL Cycle Trail 1 0 0 0 0 2 0 0 0 0 3 0 0 0 0 4 0 0 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 15/17 Preempt 6 Data Miscellaneous DET DELAY MXCAL DB/10 NLOCK EXTND L OUT SRMOD LINK# DURAT GATE R2C 253 0 0 0 0 0 0 0 0 0 0 0 Miscellaneous Interval Timings MINGRN MINWLK DWLGRN EXTPED SEL PEDCLR SELYEL/10 SELRED/10 TRKGRN TRK PEDCLR TRKYEL/10 TRKRED/10 RET PEDCLR RETYEL/10 RETRED/10 0 0 0 0 0 40 20 0 0 40 20 0 40 20 Interval Timings Preempt 7 Data Default Data Preempt 8 Data Default Data Preempt 9 Data Default Data Preempt 10 Data Default Data Preempt 11 Data Default Data Preempt 12 Data Default Data Priority Priority 1 Deafult Data Priority 2 Deafult Data Priority 3 Deafult Data Priority 4 16 0 0 0 0 Overlap Data Exit/Calls Default Data Exit/Calls Vehicle Data Default Data Vehicle Data Pedestrian Data Phase Track Green DWELL Cycle 1 0 0 0 3 0 0 0 5 0 0 0 7 0 0 0 9 0 0 0 10 0 0 0 11 0 0 0 12 0 0 0 13 0 0 0 14 0 0 0 15 0 0 0 16 0 0 0 Pedestrian Data Overlap Data Phase TrackGreen DWELL Cycle Trail 1 0 0 0 0 2 0 0 0 0 3 0 0 0 0 4 0 0 0 0 5 0 0 0 0 6 0 0 0 0 7 0 0 0 0 8 0 0 0 0 9 0 0 0 0 10 0 0 0 0 11 0 0 0 0 12 0 0 0 0 13 0 0 0 0 14 0 0 0 0 15 0 0 0 0 16 0 0 0 0 Overlap Data 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 16/17 Deafult DataPriority 5 Deafult Data Priority 6 Deafult Data Priority 7 Deafult Data Priority 8 Deafult Data Priority 9 Deafult Data Priority 10 Deafult Data Priority 11 Deafult Data Priority 12 Deafult Data System/Detector Communications Local Address: None Revert to Backup: 900.0 IP Address: None System Detector Data Bank 1: Default Data Bank 2: Default Data Bank 3: Default Data Bank 4: Default Data Queue Assignments Bank 1: Default Data Bank 2: Default Data Bank 3: Default Data Bank 4: Default Data Queue Select Bank 1: Default Data Bank 2: Default Data Bank 3: Default Data Bank 4: Default Data System/Detector Data - Detector Diagnostics System Data - Speed Measurement: 0 Vehicle Detector Diagnostics Value: 0 Default Data Vehicle Detector Diagnostics Value: 0 Vehicle Detector Diagnostics Value: 1 Default Data Vehicle Detector Diagnostics Value: 1 Pedestrian Detector Value: 0 Default Data Pedestrian Detector Value: 0 Pedestrian Detector Value: 1 Default Data Pedestrian Detector Value: 1 Special Detector Diagnostics Value: 0 Default Data Special Detector Diagnostics Value: 0 Special Detector Diagnostics Value: 1 Default Data Special Detector Diagnostics Value: 1 3/22/23, 11:37 AM F1938_20230322_1136.html file:///C:/Program Files (x86)/ITS Software/TACTICS Central/Report Data/Intersection/FM1709/F1938/RptAllData2_FM1709/F1938_20230322_1136.html 17/17 System Data - Speed Ranges/Pattern Speed Trap 1 Default Data Speed Trap 1 Speed Trap 2 Default Data Speed Trap 2 Pattern Speed Trap Low Threshold Speed Trap High Threshold Default Data Traffic Impact Analysis for Birdcall Restaurant in Southlake, Texas Page 92 Appendix F – Synchro Outputs Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)03A - Existing 2023 AM Peak Synchro 11 Report Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 7 159 1641 155 1 209 430 107 10 146 686 549 Future Volume (vph) 7 159 1641 155 1 209 430 107 10 146 686 549 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Heavy Vehicles (%) 2% 2% 2% 3% 2% 2% 4% 2% 10% 3% 2% 3% Shared Lane Traffic (%) Lane Group Flow (vph) 0 173 1870 0 0 219 559 0 0 162 1287 0 Turn Type Prot Prot NA Prot Prot NA Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases Detector Phase 5 5 2 1 1 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 5.0 5.0 10.0 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 53.0 13.0 13.0 54.0 13.0 13.0 54.0 Total Split (s) 19.0 19.0 53.0 21.0 21.0 55.0 21.0 21.0 36.0 Total Split (%) 14.6% 14.6% 40.8% 16.2% 16.2% 42.3% 16.2% 16.2% 27.7% Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 8.0 8.0 8.0 8.0 8.0 8.0 Lead/Lag Lead Lead Lead Lag Lag Lag Lead Lead Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None None C-Max None None C-Max None None None Act Effct Green (s) 10.4 45.0 13.0 47.6 11.2 28.0 Actuated g/C Ratio 0.08 0.35 0.10 0.37 0.09 0.22 v/c Ratio 0.63 1.07 0.64 0.31 0.56 1.28dr Control Delay 68.5 84.3 65.4 27.3 64.4 115.1 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 68.5 84.3 65.4 27.3 64.4 115.1 LOS EF EC EF Approach Delay 82.9 38.0 109.5 Approach LOS F D F Queue Length 50th (ft) 73 ~638 92 111 68 ~428 Queue Length 95th (ft) 112 #735 136 144 105 #527 Internal Link Dist (ft) 657 536 265 Turn Bay Length (ft) 410 430 340 Base Capacity (vph) 290 1744 343 1809 338 1128 Starvation Cap Reductn 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 Reduced v/c Ratio 0.60 1.07 0.64 0.31 0.48 1.14 Intersection Summary Cycle Length: 130 Actuated Cycle Length: 130 Offset: 52 (40%), Referenced to phase 2:EBT and 6:WBT, Start of Green Natural Cycle: 145 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.14 Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)03A - Existing 2023 AM Peak Synchro 11 Report Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 2 277 388 75 Future Volume (vph) 2 277 388 75 Peak Hour Factor 0.96 0.96 0.96 0.96 Heavy Vehicles (%) 2% 2% 2% 4% Shared Lane Traffic (%) Lane Group Flow (vph) 0 291 482 0 Turn Type Prot Prot NA Protected Phases 7 7 4 Permitted Phases Detector Phase 7 7 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 54.0 Total Split (s) 20.0 20.0 35.0 Total Split (%) 15.4% 15.4% 26.9% Yellow Time (s) 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 Total Lost Time (s) 8.0 8.0 Lead/Lag Lag Lag Lag Lead-Lag Optimize? Yes Yes Yes Recall Mode None None None Act Effct Green (s) 12.0 28.8 Actuated g/C Ratio 0.09 0.22 v/c Ratio 0.92 0.43 Control Delay 92.4 42.6 Queue Delay 0.0 0.0 Total Delay 92.4 42.6 LOS F D Approach Delay 61.3 Approach LOS E Queue Length 50th (ft) 127 121 Queue Length 95th (ft) #213 161 Internal Link Dist (ft) 603 Turn Bay Length (ft) 300 Base Capacity (vph) 316 1119 Starvation Cap Reductn 0 0 Spillback Cap Reductn 0 0 Storage Cap Reductn 0 0 Reduced v/c Ratio 0.92 0.43 Intersection Summary Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)03A - Existing 2023 AM Peak Synchro 11 Report Intersection Signal Delay: 80.3 Intersection LOS: F Intersection Capacity Utilization 101.3% ICU Level of Service G Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. dr Defacto Right Lane. Recode with 1 though lane as a right lane. Splits and Phases: 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd) HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 2: AP 1 & FM 1709 (Southlake Blvd)03A - Existing 2023 AM Peak Synchro 11 Report Intersection Int Delay, s/veh 2.5 Movement EBT EBR WBL WBT NBL NBR Lane Configurations Traffic Vol, veh/h 2499 13 0 747 0 88 Future Vol, veh/h 2499 13 0 747 0 88 Conflicting Peds, #/hr 0 00000 Sign Control Free Free Free Free Stop Stop RT Channelized - None - None - None Storage Length -----0 Veh in Median Storage, # 0 - - 0 0 - Grade, % 0 - - 0 0 - Peak Hour Factor 94 94 94 94 94 94 Heavy Vehicles, % 2 22322 Mvmt Flow 2659 14 0 795 0 94 Major/Minor Major1 Major2 Minor1 Conflicting Flow All 0 0 - - - 1337 Stage 1 ------ Stage 2 ------ Critical Hdwy -----7.14 Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy -----3.92 Pot Cap-1 Maneuver - - 0 - 0 123 Stage 1 - - 0 - 0 - Stage 2 - - 0 - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver -----123 Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach EB WB NB HCM Control Delay, s 0 0 94.2 HCM LOS F Minor Lane/Major Mvmt NBLn1 EBT EBR WBT Capacity (veh/h) 123 - - - HCM Lane V/C Ratio 0.761 - - - HCM Control Delay (s) 94.2 - - - HCM Lane LOS F - - - HCM 95th %tile Q(veh) 4.4 - - - HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 3: FM 1939 (Randol Mill) & AP 2 03A - Existing 2023 AM Peak Synchro 11 Report Intersection Int Delay, s/veh 0.1 Movement WBL WBR NBT NBR SBL SBT Lane Configurations Traffic Vol, veh/h 0 16 1359 29 0 762 Future Vol, veh/h 0 16 1359 29 0 762 Conflicting Peds, #/hr 0 00000 Sign Control Stop Stop Free Free Free Free RT Channelized - None - None - None Storage Length - 0 ---- Veh in Median Storage, # 0 - 0 - - 0 Grade, % 0 - 0 - - 0 Peak Hour Factor 87 87 87 87 87 87 Heavy Vehicles, % 2 73222 Mvmt Flow 0 18 1562 33 0 876 Major/Minor Minor1 Major1 Major2 Conflicting Flow All - 798 0 0 - - Stage 1 ------ Stage 2 ------ Critical Hdwy - 7.24 ---- Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy - 3.97 ---- Pot Cap-1 Maneuver 0 274 - - 0 - Stage 1 0 - - - 0 - Stage 2 0 - - - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver - 274 ---- Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach WB NB SB HCM Control Delay, s 19.1 0 0 HCM LOS C Minor Lane/Major Mvmt NBT NBRWBLn1 SBT Capacity (veh/h) - - 274 - HCM Lane V/C Ratio - - 0.067 - HCM Control Delay (s) - - 19.1 - HCM Lane LOS - - C - HCM 95th %tile Q(veh) - - 0.2 - Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)03B - Existing 2023 MID Peak Synchro 11 Report Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 17 376 908 176 42 151 796 176 7 175 381 158 Future Volume (vph) 17 376 908 176 42 151 796 176 7 175 381 158 Peak Hour Factor 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 Heavy Vehicles (%) 2% 2% 2% 2% 4% 3% 3% 2% 2% 2% 2% 2% Shared Lane Traffic (%) Lane Group Flow (vph) 0 418 1153 0 0 206 1034 0 0 193 573 0 Turn Type Prot Prot NA Prot Prot NA Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases Detector Phase 5 5 2 1 1 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 5.0 5.0 10.0 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 53.0 13.0 13.0 54.0 13.0 13.0 54.0 Total Split (s) 23.0 23.0 53.0 24.0 24.0 54.0 21.0 21.0 26.0 Total Split (%) 19.2% 19.2% 44.2% 20.0% 20.0% 45.0% 17.5% 17.5% 21.7% Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 8.0 8.0 8.0 8.0 8.0 8.0 Lead/Lag Lag Lag Lag Lead Lead Lead Lag Lag Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None None C-Max None None C-Max None None None Act Effct Green (s) 15.0 49.7 12.6 47.3 11.7 16.7 Actuated g/C Ratio 0.12 0.41 0.10 0.39 0.10 0.14 v/c Ratio 0.97 0.56 0.58 0.53 0.58 0.77 Control Delay 90.0 27.6 57.5 27.8 58.6 51.0 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 90.0 27.6 57.5 27.8 58.6 51.0 LOS FC EC ED Approach Delay 44.2 32.8 52.9 Approach LOS D C D Queue Length 50th (ft) 168 241 79 215 74 136 Queue Length 95th (ft) #272 303 116 260 112 180 Internal Link Dist (ft) 657 536 265 Turn Bay Length (ft) 410 430 340 Base Capacity (vph) 429 2076 452 1961 371 791 Starvation Cap Reductn 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 Reduced v/c Ratio 0.97 0.56 0.46 0.53 0.52 0.72 Intersection Summary Cycle Length: 120 Actuated Cycle Length: 120 Offset: 79 (66%), Referenced to phase 2:EBT and 6:WBT, Start of Green Natural Cycle: 145 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.17 Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)03B - Existing 2023 MID Peak Synchro 11 Report Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 36 244 363 350 Future Volume (vph) 36 244 363 350 Peak Hour Factor 0.94 0.94 0.94 0.94 Heavy Vehicles (%) 2% 3% 3% 3% Shared Lane Traffic (%) Lane Group Flow (vph) 0 298 758 0 Turn Type Prot Prot NA Protected Phases 7 7 4 Permitted Phases Detector Phase 7 7 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 54.0 Total Split (s) 17.0 17.0 22.0 Total Split (%) 14.2% 14.2% 18.3% Yellow Time (s) 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 Total Lost Time (s) 8.0 8.0 Lead/Lag Lead Lead Lead Lead-Lag Optimize? Yes Yes Yes Recall Mode None None None Act Effct Green (s) 9.0 14.0 Actuated g/C Ratio 0.08 0.12 v/c Ratio 1.17 1.14dr Control Delay 157.8 103.9 Queue Delay 0.0 0.0 Total Delay 157.8 103.9 LOS F F Approach Delay 119.1 Approach LOS F Queue Length 50th (ft) ~141 ~200 Queue Length 95th (ft) #234 #289 Internal Link Dist (ft) 603 Turn Bay Length (ft) 300 Base Capacity (vph) 255 688 Starvation Cap Reductn 0 0 Spillback Cap Reductn 0 0 Storage Cap Reductn 0 0 Reduced v/c Ratio 1.17 1.10 Intersection Summary Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)03B - Existing 2023 MID Peak Synchro 11 Report Intersection Signal Delay: 59.7 Intersection LOS: E Intersection Capacity Utilization 77.2% ICU Level of Service D Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. dr Defacto Right Lane. Recode with 1 though lane as a right lane. Splits and Phases: 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd) HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 2: AP 1 & FM 1709 (Southlake Blvd)03B - Existing 2023 MID Peak Synchro 11 Report Intersection Int Delay, s/veh 0.4 Movement EBT EBR WBL WBT NBL NBR Lane Configurations Traffic Vol, veh/h 1320 20 0 1165 0 51 Future Vol, veh/h 1320 20 0 1165 0 51 Conflicting Peds, #/hr 0 00000 Sign Control Free Free Free Free Stop Stop RT Channelized - None - None - None Storage Length -----0 Veh in Median Storage, # 0 - - 0 0 - Grade, % 0 - - 0 0 - Peak Hour Factor 94 94 94 94 94 94 Heavy Vehicles, % 3 22222 Mvmt Flow 1404 21 0 1239 0 54 Major/Minor Major1 Major2 Minor1 Conflicting Flow All 0 0 - - - 713 Stage 1 ------ Stage 2 ------ Critical Hdwy -----7.14 Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy -----3.92 Pot Cap-1 Maneuver - - 0 - 0 321 Stage 1 - - 0 - 0 - Stage 2 - - 0 - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver -----321 Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach EB WB NB HCM Control Delay, s 0 0 18.5 HCM LOS C Minor Lane/Major Mvmt NBLn1 EBT EBR WBT Capacity (veh/h) 321 - - - HCM Lane V/C Ratio 0.169 - - - HCM Control Delay (s) 18.5 - - - HCM Lane LOS C - - - HCM 95th %tile Q(veh) 0.6 - - - HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 3: FM 1939 (Randol Mill) & AP 2 03B - Existing 2023 MID Peak Synchro 11 Report Intersection Int Delay, s/veh 0.6 Movement WBL WBR NBT NBR SBL SBT Lane Configurations Traffic Vol, veh/h 0 68 947 39 0 697 Future Vol, veh/h 0 68 947 39 0 697 Conflicting Peds, #/hr 0 00000 Sign Control Stop Stop Free Free Free Free RT Channelized - None - None - None Storage Length - 0 ---- Veh in Median Storage, # 0 - 0 - - 0 Grade, % 0 - 0 - - 0 Peak Hour Factor 94 94 94 94 94 94 Heavy Vehicles, % 2 22322 Mvmt Flow 0 72 1007 41 0 741 Major/Minor Minor1 Major1 Major2 Conflicting Flow All - 524 0 0 - - Stage 1 ------ Stage 2 ------ Critical Hdwy - 7.14 ---- Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy - 3.92 ---- Pot Cap-1 Maneuver 0 426 - - 0 - Stage 1 0 - - - 0 - Stage 2 0 - - - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver - 426 ---- Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach WB NB SB HCM Control Delay, s 15.2 0 0 HCM LOS C Minor Lane/Major Mvmt NBT NBRWBLn1 SBT Capacity (veh/h) - - 426 - HCM Lane V/C Ratio - - 0.17 - HCM Control Delay (s) - - 15.2 - HCM Lane LOS - - C - HCM 95th %tile Q(veh) - - 0.6 - Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)03C - Existing 2023 PM Peak Synchro 11 Report Lane Group EBU EBL EBT EBR WBL WBT WBR NBU NBL NBT NBR SBU Lane Configurations Traffic Volume (vph) 20 155 915 198 486 1457 201 44 253 499 361 1 Future Volume (vph) 20 155 915 198 486 1457 201 44 253 499 361 1 Peak Hour Factor 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 Shared Lane Traffic (%) Lane Group Flow (vph) 0 184 1171 0 512 1746 0 0 312 905 0 0 Turn Type Prot Prot NA Prot NA Prot Prot NA Prot Protected Phases 5 5 2 1 6 3 3 8 7 Permitted Phases Detector Phase 5 5 2 1 6 3 3 8 7 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 5.0 10.0 5.0 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 53.0 13.0 54.0 13.0 13.0 54.0 13.0 Total Split (s) 23.0 23.0 54.0 35.0 66.0 23.0 23.0 41.0 20.0 Total Split (%) 15.3% 15.3% 36.0% 23.3% 44.0% 15.3% 15.3% 27.3% 13.3% Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 8.0 8.0 8.0 8.0 8.0 8.0 Lead/Lag Lag Lag Lag Lead Lead Lag Lag Lag Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None None C-Max None C-Max None None None None Act Effct Green (s) 15.0 47.4 25.6 58.0 15.0 33.0 Actuated g/C Ratio 0.10 0.32 0.17 0.39 0.10 0.22 v/c Ratio 0.54 0.74 0.87 0.90 0.91 0.88dr Control Delay 70.5 48.1 77.0 50.1 96.5 54.5 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 70.5 48.1 77.0 50.1 96.5 54.5 LOS ED ED FD Approach Delay 51.1 56.2 65.2 Approach LOS D E E Queue Length 50th (ft) 89 371 252 580 158 274 Queue Length 95th (ft) 131 428 #324 649 #247 330 Internal Link Dist (ft) 657 536 265 Turn Bay Length (ft) 410 430 340 Base Capacity (vph) 343 1585 617 1942 343 1134 Starvation Cap Reductn 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 Reduced v/c Ratio 0.54 0.74 0.83 0.90 0.91 0.80 Intersection Summary Cycle Length: 150 Actuated Cycle Length: 150 Offset: 48 (32%), Referenced to phase 2:EBT and 6:WBT, Start of Green Natural Cycle: 145 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.11 Intersection Signal Delay: 69.8 Intersection LOS: E Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)03C - Existing 2023 PM Peak Synchro 11 Report Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 243 856 216 Future Volume (vph) 243 856 216 Peak Hour Factor 0.95 0.95 0.95 Shared Lane Traffic (%) Lane Group Flow (vph) 257 1128 0 Turn Type Prot NA Protected Phases 7 4 Permitted Phases Detector Phase 7 4 Switch Phase Minimum Initial (s) 5.0 5.0 Minimum Split (s) 13.0 54.0 Total Split (s) 20.0 38.0 Total Split (%) 13.3% 25.3% Yellow Time (s) 5.0 5.0 All-Red Time (s) 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 Total Lost Time (s) 8.0 8.0 Lead/Lag Lead Lead Lead-Lag Optimize? Yes Yes Recall Mode None None Act Effct Green (s) 12.0 30.0 Actuated g/C Ratio 0.08 0.20 v/c Ratio 0.94 1.11 Control Delay 108.1 115.6 Queue Delay 0.0 0.0 Total Delay 108.1 115.6 LOS F F Approach Delay 114.2 Approach LOS F Queue Length 50th (ft) 131 ~450 Queue Length 95th (ft) #219 #549 Internal Link Dist (ft) 603 Turn Bay Length (ft) 300 Base Capacity (vph) 274 1016 Starvation Cap Reductn 0 0 Spillback Cap Reductn 0 0 Storage Cap Reductn 0 0 Reduced v/c Ratio 0.94 1.11 Intersection Summary Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)03C - Existing 2023 PM Peak Synchro 11 Report Intersection Capacity Utilization 94.1% ICU Level of Service F Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. dr Defacto Right Lane. Recode with 1 though lane as a right lane. Splits and Phases: 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd) HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 2: AP 1 & FM 1709 (Southlake Blvd)03C - Existing 2023 PM Peak Synchro 11 Report Intersection Int Delay, s/veh 0.2 Movement EBT EBR WBL WBT NBL NBR Lane Configurations Traffic Vol, veh/h 1471 13 0 2144 0 44 Future Vol, veh/h 1471 13 0 2144 0 44 Conflicting Peds, #/hr 0 00000 Sign Control Free Free Free Free Stop Stop RT Channelized - None - None - None Storage Length -----0 Veh in Median Storage, # 0 - - 0 0 - Grade, % 0 - - 0 0 - Peak Hour Factor 97 97 97 97 97 97 Heavy Vehicles, % 2 22222 Mvmt Flow 1516 13 0 2210 0 45 Major/Minor Major1 Major2 Minor1 Conflicting Flow All 0 0 - - - 765 Stage 1 ------ Stage 2 ------ Critical Hdwy -----7.14 Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy -----3.92 Pot Cap-1 Maneuver - - 0 - 0 297 Stage 1 - - 0 - 0 - Stage 2 - - 0 - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver -----297 Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach EB WB NB HCM Control Delay, s 0 0 19.3 HCM LOS C Minor Lane/Major Mvmt NBLn1 EBT EBR WBT Capacity (veh/h) 297 - - - HCM Lane V/C Ratio 0.153 - - - HCM Control Delay (s) 19.3 - - - HCM Lane LOS C - - - HCM 95th %tile Q(veh) 0.5 - - - HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 3: FM 1939 (Randol Mill) & AP 2 03C - Existing 2023 PM Peak Synchro 11 Report Intersection Int Delay, s/veh 0.6 Movement WBL WBR NBT NBR SBL SBT Lane Configurations Traffic Vol, veh/h 0 84 1140 45 0 1584 Future Vol, veh/h 0 84 1140 45 0 1584 Conflicting Peds, #/hr 0 00000 Sign Control Stop Stop Free Free Free Free RT Channelized - None - None - None Storage Length - 0 ---- Veh in Median Storage, # 0 - 0 - - 0 Grade, % 0 - 0 - - 0 Peak Hour Factor 90 90 90 90 90 90 Heavy Vehicles, % 2 22222 Mvmt Flow 0 93 1267 50 0 1760 Major/Minor Minor1 Major1 Major2 Conflicting Flow All - 659 0 0 - - Stage 1 ------ Stage 2 ------ Critical Hdwy - 7.14 ---- Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy - 3.92 ---- Pot Cap-1 Maneuver 0 348 - - 0 - Stage 1 0 - - - 0 - Stage 2 0 - - - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver - 348 ---- Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach WB NB SB HCM Control Delay, s 19.1 0 0 HCM LOS C Minor Lane/Major Mvmt NBT NBRWBLn1 SBT Capacity (veh/h) - - 348 - HCM Lane V/C Ratio - - 0.268 - HCM Control Delay (s) - - 19.1 - HCM Lane LOS - - C - HCM 95th %tile Q(veh) - - 1.1 - Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)04A - Background 2024 AM Peak Synchro 11 Report Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 8 163 1674 159 2 214 439 110 11 149 700 560 Future Volume (vph) 8 163 1674 159 2 214 439 110 11 149 700 560 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Heavy Vehicles (%) 2% 2% 2% 3% 2% 2% 4% 2% 10% 3% 2% 3% Shared Lane Traffic (%) Lane Group Flow (vph) 0 178 1910 0 0 225 572 0 0 166 1312 0 Turn Type Prot Prot NA Prot Prot NA Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases Detector Phase 5 5 2 1 1 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 5.0 5.0 10.0 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 53.0 13.0 13.0 54.0 13.0 13.0 54.0 Total Split (s) 19.0 19.0 53.0 21.0 21.0 55.0 21.0 21.0 36.0 Total Split (%) 14.6% 14.6% 40.8% 16.2% 16.2% 42.3% 16.2% 16.2% 27.7% Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 8.0 8.0 8.0 8.0 8.0 8.0 Lead/Lag Lead Lead Lead Lag Lag Lag Lead Lead Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None None C-Max None None C-Max None None None Act Effct Green (s) 10.5 45.0 13.0 47.5 11.3 28.0 Actuated g/C Ratio 0.08 0.35 0.10 0.37 0.09 0.22 v/c Ratio 0.64 1.10 0.66 0.32 0.57 1.30dr Control Delay 69.1 92.4 66.2 27.3 64.5 123.5 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 69.1 92.4 66.2 27.3 64.5 123.5 LOS EF EC EF Approach Delay 90.4 38.3 116.9 Approach LOS F D F Queue Length 50th (ft) 75 ~664 95 114 70 ~444 Queue Length 95th (ft) 115 #761 140 147 107 #542 Internal Link Dist (ft) 657 536 265 Turn Bay Length (ft) 410 430 340 Base Capacity (vph) 290 1744 343 1808 338 1128 Starvation Cap Reductn 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 Reduced v/c Ratio 0.61 1.10 0.66 0.32 0.49 1.16 Intersection Summary Cycle Length: 130 Actuated Cycle Length: 130 Offset: 52 (40%), Referenced to phase 2:EBT and 6:WBT, Start of Green Natural Cycle: 145 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.16 Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)04A - Background 2024 AM Peak Synchro 11 Report Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 3 283 396 77 Future Volume (vph) 3 283 396 77 Peak Hour Factor 0.96 0.96 0.96 0.96 Heavy Vehicles (%) 2% 2% 2% 4% Shared Lane Traffic (%) Lane Group Flow (vph) 0 298 493 0 Turn Type Prot Prot NA Protected Phases 7 7 4 Permitted Phases Detector Phase 7 7 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 54.0 Total Split (s) 20.0 20.0 35.0 Total Split (%) 15.4% 15.4% 26.9% Yellow Time (s) 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 Total Lost Time (s) 8.0 8.0 Lead/Lag Lag Lag Lag Lead-Lag Optimize? Yes Yes Yes Recall Mode None None None Act Effct Green (s) 12.0 28.7 Actuated g/C Ratio 0.09 0.22 v/c Ratio 0.94 0.44 Control Delay 96.5 42.9 Queue Delay 0.0 0.0 Total Delay 96.5 42.9 LOS F D Approach Delay 63.1 Approach LOS E Queue Length 50th (ft) 130 125 Queue Length 95th (ft) #219 165 Internal Link Dist (ft) 603 Turn Bay Length (ft) 300 Base Capacity (vph) 316 1114 Starvation Cap Reductn 0 0 Spillback Cap Reductn 0 0 Storage Cap Reductn 0 0 Reduced v/c Ratio 0.94 0.44 Intersection Summary Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)04A - Background 2024 AM Peak Synchro 11 Report Intersection Signal Delay: 85.8 Intersection LOS: F Intersection Capacity Utilization 103.0% ICU Level of Service G Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. dr Defacto Right Lane. Recode with 1 though lane as a right lane. Splits and Phases: 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd) HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 2: AP 1 & FM 1709 (Southlake Blvd)04A - Background 2024 AM Peak Synchro 11 Report Intersection Int Delay, s/veh 2.8 Movement EBT EBR WBL WBT NBL NBR Lane Configurations Traffic Vol, veh/h 2549 14 0 762 0 90 Future Vol, veh/h 2549 14 0 762 0 90 Conflicting Peds, #/hr 0 00000 Sign Control Free Free Free Free Stop Stop RT Channelized - None - None - None Storage Length -----0 Veh in Median Storage, # 0 - - 0 0 - Grade, % 0 - - 0 0 - Peak Hour Factor 94 94 94 94 94 94 Heavy Vehicles, % 2 22322 Mvmt Flow 2712 15 0 811 0 96 Major/Minor Major1 Major2 Minor1 Conflicting Flow All 0 0 - - - 1364 Stage 1 ------ Stage 2 ------ Critical Hdwy -----7.14 Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy -----3.92 Pot Cap-1 Maneuver - - 0 - 0 118 Stage 1 - - 0 - 0 - Stage 2 - - 0 - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver -----118 Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach EB WB NB HCM Control Delay, s 0 0 106.8 HCM LOS F Minor Lane/Major Mvmt NBLn1 EBT EBR WBT Capacity (veh/h) 118 - - - HCM Lane V/C Ratio 0.811 - - - HCM Control Delay (s) 106.8 - - - HCM Lane LOS F - - - HCM 95th %tile Q(veh) 4.8 - - - HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 3: FM 1939 (Randol Mill) & AP 2 04A - Background 2024 AM Peak Synchro 11 Report Intersection Int Delay, s/veh 0.1 Movement WBL WBR NBT NBR SBL SBT Lane Configurations Traffic Vol, veh/h 0 17 1387 30 0 778 Future Vol, veh/h 0 17 1387 30 0 778 Conflicting Peds, #/hr 0 00000 Sign Control Stop Stop Free Free Free Free RT Channelized - None - None - None Storage Length - 0 ---- Veh in Median Storage, # 0 - 0 - - 0 Grade, % 0 - 0 - - 0 Peak Hour Factor 87 87 87 87 87 87 Heavy Vehicles, % 2 73222 Mvmt Flow 0 20 1594 34 0 894 Major/Minor Minor1 Major1 Major2 Conflicting Flow All - 814 0 0 - - Stage 1 ------ Stage 2 ------ Critical Hdwy - 7.24 ---- Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy - 3.97 ---- Pot Cap-1 Maneuver 0 267 - - 0 - Stage 1 0 - - - 0 - Stage 2 0 - - - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver - 267 ---- Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach WB NB SB HCM Control Delay, s 19.5 0 0 HCM LOS C Minor Lane/Major Mvmt NBT NBRWBLn1 SBT Capacity (veh/h) - - 267 - HCM Lane V/C Ratio - - 0.073 - HCM Control Delay (s) - - 19.5 - HCM Lane LOS - - C - HCM 95th %tile Q(veh) - - 0.2 - Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)04B - Background 2024 MID Peak Synchro 11 Report Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 18 384 927 180 43 155 812 180 8 179 389 162 Future Volume (vph) 18 384 927 180 43 155 812 180 8 179 389 162 Peak Hour Factor 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 Heavy Vehicles (%) 2% 2% 2% 2% 4% 3% 3% 2% 2% 2% 2% 2% Shared Lane Traffic (%) Lane Group Flow (vph) 0 428 1177 0 0 211 1055 0 0 199 586 0 Turn Type Prot Prot NA Prot Prot NA Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases Detector Phase 5 5 2 1 1 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 5.0 5.0 10.0 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 53.0 13.0 13.0 54.0 13.0 13.0 54.0 Total Split (s) 23.0 23.0 53.0 24.0 24.0 54.0 21.0 21.0 26.0 Total Split (%) 19.2% 19.2% 44.2% 20.0% 20.0% 45.0% 17.5% 17.5% 21.7% Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 8.0 8.0 8.0 8.0 8.0 8.0 Lead/Lag Lag Lag Lag Lead Lead Lead Lag Lag Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None None C-Max None None C-Max None None None Act Effct Green (s) 15.0 49.5 12.7 47.2 11.8 16.8 Actuated g/C Ratio 0.12 0.41 0.11 0.39 0.10 0.14 v/c Ratio 1.00 0.57 0.59 0.54 0.59 0.79 Control Delay 95.6 28.0 57.7 28.1 59.0 51.6 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 95.6 28.0 57.7 28.1 59.0 51.6 LOS FC EC ED Approach Delay 46.0 33.0 53.4 Approach LOS D C D Queue Length 50th (ft) 173 249 81 221 76 141 Queue Length 95th (ft) #281 311 119 266 115 185 Internal Link Dist (ft) 657 536 265 Turn Bay Length (ft) 410 430 340 Base Capacity (vph) 429 2068 452 1958 371 792 Starvation Cap Reductn 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 Reduced v/c Ratio 1.00 0.57 0.47 0.54 0.54 0.74 Intersection Summary Cycle Length: 120 Actuated Cycle Length: 120 Offset: 79 (66%), Referenced to phase 2:EBT and 6:WBT, Start of Green Natural Cycle: 145 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.19 Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)04B - Background 2024 MID Peak Synchro 11 Report Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 37 249 371 357 Future Volume (vph) 37 249 371 357 Peak Hour Factor 0.94 0.94 0.94 0.94 Heavy Vehicles (%) 2% 3% 3% 3% Shared Lane Traffic (%) Lane Group Flow (vph) 0 304 775 0 Turn Type Prot Prot NA Protected Phases 7 7 4 Permitted Phases Detector Phase 7 7 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 54.0 Total Split (s) 17.0 17.0 22.0 Total Split (%) 14.2% 14.2% 18.3% Yellow Time (s) 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 Total Lost Time (s) 8.0 8.0 Lead/Lag Lead Lead Lead Lead-Lag Optimize? Yes Yes Yes Recall Mode None None None Act Effct Green (s) 9.0 14.0 Actuated g/C Ratio 0.08 0.12 v/c Ratio 1.19 1.17dr Control Delay 165.6 112.6 Queue Delay 0.0 0.0 Total Delay 165.6 112.6 LOS F F Approach Delay 127.5 Approach LOS F Queue Length 50th (ft) ~146 ~211 Queue Length 95th (ft) #238 #300 Internal Link Dist (ft) 603 Turn Bay Length (ft) 300 Base Capacity (vph) 255 688 Starvation Cap Reductn 0 0 Spillback Cap Reductn 0 0 Storage Cap Reductn 0 0 Reduced v/c Ratio 1.19 1.13 Intersection Summary Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)04B - Background 2024 MID Peak Synchro 11 Report Intersection Signal Delay: 62.3 Intersection LOS: E Intersection Capacity Utilization 78.4% ICU Level of Service D Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. dr Defacto Right Lane. Recode with 1 though lane as a right lane. Splits and Phases: 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd) HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 2: AP 1 & FM 1709 (Southlake Blvd)04B - Background 2024 MID Peak Synchro 11 Report Intersection Int Delay, s/veh 0.4 Movement EBT EBR WBL WBT NBL NBR Lane Configurations Traffic Vol, veh/h 1347 21 0 1189 0 53 Future Vol, veh/h 1347 21 0 1189 0 53 Conflicting Peds, #/hr 0 00000 Sign Control Free Free Free Free Stop Stop RT Channelized - None - None - None Storage Length -----0 Veh in Median Storage, # 0 - - 0 0 - Grade, % 0 - - 0 0 - Peak Hour Factor 94 94 94 94 94 94 Heavy Vehicles, % 3 22222 Mvmt Flow 1433 22 0 1265 0 56 Major/Minor Major1 Major2 Minor1 Conflicting Flow All 0 0 - - - 728 Stage 1 ------ Stage 2 ------ Critical Hdwy -----7.14 Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy -----3.92 Pot Cap-1 Maneuver - - 0 - 0 314 Stage 1 - - 0 - 0 - Stage 2 - - 0 - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver -----314 Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach EB WB NB HCM Control Delay, s 0 0 19 HCM LOS C Minor Lane/Major Mvmt NBLn1 EBT EBR WBT Capacity (veh/h) 314 - - - HCM Lane V/C Ratio 0.18 - - - HCM Control Delay (s) 19 - - - HCM Lane LOS C - - - HCM 95th %tile Q(veh) 0.6 - - - HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 3: FM 1939 (Randol Mill) & AP 2 04B - Background 2024 MID Peak Synchro 11 Report Intersection Int Delay, s/veh 0.6 Movement WBL WBR NBT NBR SBL SBT Lane Configurations Traffic Vol, veh/h 0 70 966 40 0 711 Future Vol, veh/h 0 70 966 40 0 711 Conflicting Peds, #/hr 0 00000 Sign Control Stop Stop Free Free Free Free RT Channelized - None - None - None Storage Length - 0 ---- Veh in Median Storage, # 0 - 0 - - 0 Grade, % 0 - 0 - - 0 Peak Hour Factor 94 94 94 94 94 94 Heavy Vehicles, % 2 22322 Mvmt Flow 0 74 1028 43 0 756 Major/Minor Minor1 Major1 Major2 Conflicting Flow All - 536 0 0 - - Stage 1 ------ Stage 2 ------ Critical Hdwy - 7.14 ---- Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy - 3.92 ---- Pot Cap-1 Maneuver 0 419 - - 0 - Stage 1 0 - - - 0 - Stage 2 0 - - - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver - 419 ---- Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach WB NB SB HCM Control Delay, s 15.4 0 0 HCM LOS C Minor Lane/Major Mvmt NBT NBRWBLn1 SBT Capacity (veh/h) - - 419 - HCM Lane V/C Ratio - - 0.178 - HCM Control Delay (s) - - 15.4 - HCM Lane LOS - - C - HCM 95th %tile Q(veh) - - 0.6 - Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)04C - Background 2024 PM Peak Synchro 11 Report Lane Group EBU EBL EBT EBR WBL WBT WBR NBU NBL NBT NBR SBU Lane Configurations Traffic Volume (vph) 21 159 934 202 496 1487 206 45 259 509 369 2 Future Volume (vph) 21 159 934 202 496 1487 206 45 259 509 369 2 Peak Hour Factor 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 Shared Lane Traffic (%) Lane Group Flow (vph) 0 189 1196 0 522 1782 0 0 320 924 0 0 Turn Type Prot Prot NA Prot NA Prot Prot NA Prot Protected Phases 5 5 2 1 6 3 3 8 7 Permitted Phases Detector Phase 5 5 2 1 6 3 3 8 7 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 5.0 10.0 5.0 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 53.0 13.0 54.0 13.0 13.0 54.0 13.0 Total Split (s) 23.0 23.0 54.0 35.0 66.0 23.0 23.0 41.0 20.0 Total Split (%) 15.3% 15.3% 36.0% 23.3% 44.0% 15.3% 15.3% 27.3% 13.3% Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 8.0 8.0 8.0 8.0 8.0 8.0 Lead/Lag Lag Lag Lag Lead Lead Lag Lag Lag Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None None C-Max None C-Max None None None None Act Effct Green (s) 15.0 47.2 25.8 58.0 15.0 33.0 Actuated g/C Ratio 0.10 0.31 0.17 0.39 0.10 0.22 v/c Ratio 0.55 0.76 0.88 0.92 0.93 0.89dr Control Delay 70.9 48.9 77.9 51.8 100.4 55.3 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 70.9 48.9 77.9 51.8 100.4 55.3 LOS ED ED FE Approach Delay 51.9 57.7 66.9 Approach LOS D E E Queue Length 50th (ft) 92 381 257 599 162 282 Queue Length 95th (ft) 135 440 #340 669 #257 338 Internal Link Dist (ft) 657 536 265 Turn Bay Length (ft) 410 430 340 Base Capacity (vph) 343 1579 617 1942 343 1135 Starvation Cap Reductn 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 Reduced v/c Ratio 0.55 0.76 0.85 0.92 0.93 0.81 Intersection Summary Cycle Length: 150 Actuated Cycle Length: 150 Offset: 48 (32%), Referenced to phase 2:EBT and 6:WBT, Start of Green Natural Cycle: 145 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.13 Intersection Signal Delay: 72.6 Intersection LOS: E Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)04C - Background 2024 PM Peak Synchro 11 Report Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 248 874 221 Future Volume (vph) 248 874 221 Peak Hour Factor 0.95 0.95 0.95 Shared Lane Traffic (%) Lane Group Flow (vph) 263 1153 0 Turn Type Prot NA Protected Phases 7 4 Permitted Phases Detector Phase 7 4 Switch Phase Minimum Initial (s) 5.0 5.0 Minimum Split (s) 13.0 54.0 Total Split (s) 20.0 38.0 Total Split (%) 13.3% 25.3% Yellow Time (s) 5.0 5.0 All-Red Time (s) 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 Total Lost Time (s) 8.0 8.0 Lead/Lag Lead Lead Lead-Lag Optimize? Yes Yes Recall Mode None None Act Effct Green (s) 12.0 30.0 Actuated g/C Ratio 0.08 0.20 v/c Ratio 0.96 1.13 Control Delay 112.6 124.1 Queue Delay 0.0 0.0 Total Delay 112.6 124.1 LOS F F Approach Delay 121.9 Approach LOS F Queue Length 50th (ft) 134 ~469 Queue Length 95th (ft) #227 #567 Internal Link Dist (ft) 603 Turn Bay Length (ft) 300 Base Capacity (vph) 274 1016 Starvation Cap Reductn 0 0 Spillback Cap Reductn 0 0 Storage Cap Reductn 0 0 Reduced v/c Ratio 0.96 1.13 Intersection Summary Timings 01 - Existing 2023 & Background 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)04C - Background 2024 PM Peak Synchro 11 Report Intersection Capacity Utilization 95.6% ICU Level of Service F Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. dr Defacto Right Lane. Recode with 1 though lane as a right lane. Splits and Phases: 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd) HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 2: AP 1 & FM 1709 (Southlake Blvd)04C - Background 2024 PM Peak Synchro 11 Report Intersection Int Delay, s/veh 0.2 Movement EBT EBR WBL WBT NBL NBR Lane Configurations Traffic Vol, veh/h 1501 14 0 2187 0 45 Future Vol, veh/h 1501 14 0 2187 0 45 Conflicting Peds, #/hr 0 00000 Sign Control Free Free Free Free Stop Stop RT Channelized - None - None - None Storage Length -----0 Veh in Median Storage, # 0 - - 0 0 - Grade, % 0 - - 0 0 - Peak Hour Factor 97 97 97 97 97 97 Heavy Vehicles, % 2 22222 Mvmt Flow 1547 14 0 2255 0 46 Major/Minor Major1 Major2 Minor1 Conflicting Flow All 0 0 - - - 781 Stage 1 ------ Stage 2 ------ Critical Hdwy -----7.14 Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy -----3.92 Pot Cap-1 Maneuver - - 0 - 0 290 Stage 1 - - 0 - 0 - Stage 2 - - 0 - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver -----290 Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach EB WB NB HCM Control Delay, s 0 0 19.8 HCM LOS C Minor Lane/Major Mvmt NBLn1 EBT EBR WBT Capacity (veh/h) 290 - - - HCM Lane V/C Ratio 0.16 - - - HCM Control Delay (s) 19.8 - - - HCM Lane LOS C - - - HCM 95th %tile Q(veh) 0.6 - - - HCM 6th TWSC 01 - Existing 2023 & Background 2024 Lane Configuration.syn 3: FM 1939 (Randol Mill) & AP 2 04C - Background 2024 PM Peak Synchro 11 Report Intersection Int Delay, s/veh 0.6 Movement WBL WBR NBT NBR SBL SBT Lane Configurations Traffic Vol, veh/h 0 86 1163 46 0 1616 Future Vol, veh/h 0 86 1163 46 0 1616 Conflicting Peds, #/hr 0 00000 Sign Control Stop Stop Free Free Free Free RT Channelized - None - None - None Storage Length - 0 ---- Veh in Median Storage, # 0 - 0 - - 0 Grade, % 0 - 0 - - 0 Peak Hour Factor 90 90 90 90 90 90 Heavy Vehicles, % 2 22222 Mvmt Flow 0 96 1292 51 0 1796 Major/Minor Minor1 Major1 Major2 Conflicting Flow All - 672 0 0 - - Stage 1 ------ Stage 2 ------ Critical Hdwy - 7.14 ---- Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy - 3.92 ---- Pot Cap-1 Maneuver 0 342 - - 0 - Stage 1 0 - - - 0 - Stage 2 0 - - - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver - 342 ---- Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach WB NB SB HCM Control Delay, s 19.6 0 0 HCM LOS C Minor Lane/Major Mvmt NBT NBRWBLn1 SBT Capacity (veh/h) - - 342 - HCM Lane V/C Ratio - - 0.279 - HCM Control Delay (s) - - 19.6 - HCM Lane LOS - - C - HCM 95th %tile Q(veh) - - 1.1 - Timings 02 - Buildout 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)10A - Buildout 2024 AM Peak Synchro 11 Report Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 8 163 1683 159 2 214 430 110 23 166 706 560 Future Volume (vph) 8 163 1683 159 2 214 430 110 23 166 706 560 Peak Hour Factor 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 0.96 Heavy Vehicles (%) 2% 2% 2% 3% 2% 2% 4% 2% 10% 3% 2% 3% Shared Lane Traffic (%) Lane Group Flow (vph) 0 178 1919 0 0 225 563 0 0 197 1318 0 Turn Type Prot Prot NA Prot Prot NA Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases Detector Phase 5 5 2 1 1 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 5.0 5.0 10.0 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 53.0 13.0 13.0 54.0 13.0 13.0 54.0 Total Split (s) 19.0 19.0 53.0 21.0 21.0 55.0 21.0 21.0 36.0 Total Split (%) 14.6% 14.6% 40.8% 16.2% 16.2% 42.3% 16.2% 16.2% 27.7% Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 8.0 8.0 8.0 8.0 8.0 8.0 Lead/Lag Lead Lead Lead Lag Lag Lag Lead Lead Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None None C-Max None None C-Max None None None Act Effct Green (s) 10.5 45.0 13.0 47.5 11.9 28.0 Actuated g/C Ratio 0.08 0.35 0.10 0.37 0.09 0.22 v/c Ratio 0.64 1.10 0.66 0.31 0.64 1.30dr Control Delay 69.1 94.3 66.2 27.1 66.6 125.7 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 69.1 94.3 66.2 27.1 66.6 125.7 LOS EF EC EF Approach Delay 92.1 38.3 118.0 Approach LOS F D F Queue Length 50th (ft) 75 ~670 95 111 82 ~449 Queue Length 95th (ft) 115 #767 140 144 124 #547 Internal Link Dist (ft) 657 536 265 Turn Bay Length (ft) 410 430 340 Base Capacity (vph) 290 1744 343 1808 337 1128 Starvation Cap Reductn 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 Reduced v/c Ratio 0.61 1.10 0.66 0.31 0.58 1.17 Intersection Summary Cycle Length: 130 Actuated Cycle Length: 130 Offset: 52 (40%), Referenced to phase 2:EBT and 6:WBT, Start of Green Natural Cycle: 145 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.17 Timings 02 - Buildout 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)10A - Buildout 2024 AM Peak Synchro 11 Report Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 3 295 390 77 Future Volume (vph) 3 295 390 77 Peak Hour Factor 0.96 0.96 0.96 0.96 Heavy Vehicles (%) 2% 2% 2% 4% Shared Lane Traffic (%) Lane Group Flow (vph) 0 310 486 0 Turn Type Prot Prot NA Protected Phases 7 7 4 Permitted Phases Detector Phase 7 7 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 54.0 Total Split (s) 20.0 20.0 35.0 Total Split (%) 15.4% 15.4% 26.9% Yellow Time (s) 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 Total Lost Time (s) 8.0 8.0 Lead/Lag Lag Lag Lag Lead-Lag Optimize? Yes Yes Yes Recall Mode None None None Act Effct Green (s) 12.0 28.1 Actuated g/C Ratio 0.09 0.22 v/c Ratio 0.98 0.45 Control Delay 104.7 43.2 Queue Delay 0.0 0.0 Total Delay 104.7 43.2 LOS F D Approach Delay 67.1 Approach LOS E Queue Length 50th (ft) 136 124 Queue Length 95th (ft) #232 162 Internal Link Dist (ft) 603 Turn Bay Length (ft) 300 Base Capacity (vph) 316 1090 Starvation Cap Reductn 0 0 Spillback Cap Reductn 0 0 Storage Cap Reductn 0 0 Reduced v/c Ratio 0.98 0.45 Intersection Summary Timings 02 - Buildout 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)10A - Buildout 2024 AM Peak Synchro 11 Report Intersection Signal Delay: 87.7 Intersection LOS: F Intersection Capacity Utilization 103.6% ICU Level of Service G Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. dr Defacto Right Lane. Recode with 1 though lane as a right lane. Splits and Phases: 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd) HCM 6th TWSC 02 - Buildout 2024 Lane Configuration.syn 2: AP 1 & FM 1709 (Southlake Blvd)10A - Buildout 2024 AM Peak Synchro 11 Report Intersection Int Delay, s/veh 4.5 Movement EBT EBR WBL WBT NBL NBR Lane Configurations Traffic Vol, veh/h 2540 37 0 753 0 107 Future Vol, veh/h 2540 37 0 753 0 107 Conflicting Peds, #/hr 0 00000 Sign Control Free Free Free Free Stop Stop RT Channelized - None - None - None Storage Length -----0 Veh in Median Storage, # 0 - - 0 0 - Grade, % 0 - - 0 0 - Peak Hour Factor 94 94 94 94 94 94 Heavy Vehicles, % 2 22322 Mvmt Flow 2702 39 0 801 0 114 Major/Minor Major1 Major2 Minor1 Conflicting Flow All 0 0 - - - 1371 Stage 1 ------ Stage 2 ------ Critical Hdwy -----7.14 Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy -----3.92 Pot Cap-1 Maneuver - - 0 - 0 117 Stage 1 - - 0 - 0 - Stage 2 - - 0 - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver -----117 Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach EB WB NB HCM Control Delay, s 0 0 145.9 HCM LOS F Minor Lane/Major Mvmt NBLn1 EBT EBR WBT Capacity (veh/h) 117 - - - HCM Lane V/C Ratio 0.973 - - - HCM Control Delay (s) 145.9 - - - HCM Lane LOS F - - - HCM 95th %tile Q(veh) 6.3 - - - HCM 6th TWSC 02 - Buildout 2024 Lane Configuration.syn 3: FM 1939 (Randol Mill) & AP 2 10A - Buildout 2024 AM Peak Synchro 11 Report Intersection Int Delay, s/veh 0.6 Movement WBL WBR NBT NBR SBL SBT Lane Configurations Traffic Vol, veh/h 0 55 1381 42 0 784 Future Vol, veh/h 0 55 1381 42 0 784 Conflicting Peds, #/hr 0 00000 Sign Control Stop Stop Free Free Free Free RT Channelized - None - None - None Storage Length - 0 ---- Veh in Median Storage, # 0 - 0 - - 0 Grade, % 0 - 0 - - 0 Peak Hour Factor 87 87 87 87 87 87 Heavy Vehicles, % 2 73222 Mvmt Flow 0 63 1587 48 0 901 Major/Minor Minor1 Major1 Major2 Conflicting Flow All - 818 0 0 - - Stage 1 ------ Stage 2 ------ Critical Hdwy - 7.24 ---- Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy - 3.97 ---- Pot Cap-1 Maneuver 0 266 - - 0 - Stage 1 0 - - - 0 - Stage 2 0 - - - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver - 266 ---- Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach WB NB SB HCM Control Delay, s 22.7 0 0 HCM LOS C Minor Lane/Major Mvmt NBT NBRWBLn1 SBT Capacity (veh/h) - - 266 - HCM Lane V/C Ratio - - 0.238 - HCM Control Delay (s) - - 22.7 - HCM Lane LOS - - C - HCM 95th %tile Q(veh) - - 0.9 - Timings 02 - Buildout 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)10B - Buildout 2024 MID Peak Synchro 11 Report Lane Group EBU EBL EBT EBR WBU WBL WBT WBR NBU NBL NBT NBR Lane Configurations Traffic Volume (vph) 18 384 937 180 43 155 802 180 21 198 396 162 Future Volume (vph) 18 384 937 180 43 155 802 180 21 198 396 162 Peak Hour Factor 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 0.94 Heavy Vehicles (%) 2% 2% 2% 2% 4% 3% 3% 2% 2% 2% 2% 2% Shared Lane Traffic (%) Lane Group Flow (vph) 0 428 1188 0 0 211 1044 0 0 233 593 0 Turn Type Prot Prot NA Prot Prot NA Prot Prot NA Protected Phases 5 5 2 1 1 6 3 3 8 Permitted Phases Detector Phase 5 5 2 1 1 6 3 3 8 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 5.0 5.0 10.0 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 53.0 13.0 13.0 54.0 13.0 13.0 54.0 Total Split (s) 23.0 23.0 53.0 24.0 24.0 54.0 21.0 21.0 26.0 Total Split (%) 19.2% 19.2% 44.2% 20.0% 20.0% 45.0% 17.5% 17.5% 21.7% Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 8.0 8.0 8.0 8.0 8.0 8.0 Lead/Lag Lag Lag Lag Lead Lead Lead Lag Lag Lag Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None None C-Max None None C-Max None None None Act Effct Green (s) 15.0 49.2 12.7 46.9 12.1 17.1 Actuated g/C Ratio 0.12 0.41 0.11 0.39 0.10 0.14 v/c Ratio 1.00 0.58 0.59 0.54 0.67 0.78 Control Delay 95.6 28.3 57.7 28.1 62.0 51.5 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 95.6 28.3 57.7 28.1 62.0 51.5 LOS FC EC ED Approach Delay 46.1 33.1 54.5 Approach LOS D C D Queue Length 50th (ft) 173 252 81 217 90 143 Queue Length 95th (ft) #281 315 119 263 134 188 Internal Link Dist (ft) 657 536 265 Turn Bay Length (ft) 410 430 340 Base Capacity (vph) 429 2056 452 1947 371 790 Starvation Cap Reductn 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 Reduced v/c Ratio 1.00 0.58 0.47 0.54 0.63 0.75 Intersection Summary Cycle Length: 120 Actuated Cycle Length: 120 Offset: 79 (66%), Referenced to phase 2:EBT and 6:WBT, Start of Green Natural Cycle: 145 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.25 Timings 02 - Buildout 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)10B - Buildout 2024 MID Peak Synchro 11 Report Lane Group SBU SBL SBT SBR Lane Configurations Traffic Volume (vph) 37 263 364 357 Future Volume (vph) 37 263 364 357 Peak Hour Factor 0.94 0.94 0.94 0.94 Heavy Vehicles (%) 2% 3% 3% 3% Shared Lane Traffic (%) Lane Group Flow (vph) 0 319 767 0 Turn Type Prot Prot NA Protected Phases 7 7 4 Permitted Phases Detector Phase 7 7 4 Switch Phase Minimum Initial (s) 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 54.0 Total Split (s) 17.0 17.0 22.0 Total Split (%) 14.2% 14.2% 18.3% Yellow Time (s) 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 Total Lost Time (s) 8.0 8.0 Lead/Lag Lead Lead Lead Lead-Lag Optimize? Yes Yes Yes Recall Mode None None None Act Effct Green (s) 9.0 14.0 Actuated g/C Ratio 0.08 0.12 v/c Ratio 1.25 1.15dr Control Delay 186.2 105.9 Queue Delay 0.0 0.0 Total Delay 186.2 105.9 LOS F F Approach Delay 129.5 Approach LOS F Queue Length 50th (ft) ~158 ~204 Queue Length 95th (ft) #253 #292 Internal Link Dist (ft) 603 Turn Bay Length (ft) 300 Base Capacity (vph) 255 692 Starvation Cap Reductn 0 0 Spillback Cap Reductn 0 0 Storage Cap Reductn 0 0 Reduced v/c Ratio 1.25 1.11 Intersection Summary Timings 02 - Buildout 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)10B - Buildout 2024 MID Peak Synchro 11 Report Intersection Signal Delay: 63.1 Intersection LOS: E Intersection Capacity Utilization 78.9% ICU Level of Service D Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. dr Defacto Right Lane. Recode with 1 though lane as a right lane. Splits and Phases: 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd) HCM 6th TWSC 02 - Buildout 2024 Lane Configuration.syn 2: AP 1 & FM 1709 (Southlake Blvd)10B - Buildout 2024 MID Peak Synchro 11 Report Intersection Int Delay, s/veh 0.6 Movement EBT EBR WBL WBT NBL NBR Lane Configurations Traffic Vol, veh/h 1337 47 0 1179 0 72 Future Vol, veh/h 1337 47 0 1179 0 72 Conflicting Peds, #/hr 0 00000 Sign Control Free Free Free Free Stop Stop RT Channelized - None - None - None Storage Length -----0 Veh in Median Storage, # 0 - - 0 0 - Grade, % 0 - - 0 0 - Peak Hour Factor 94 94 94 94 94 94 Heavy Vehicles, % 3 22222 Mvmt Flow 1422 50 0 1254 0 77 Major/Minor Major1 Major2 Minor1 Conflicting Flow All 0 0 - - - 736 Stage 1 ------ Stage 2 ------ Critical Hdwy -----7.14 Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy -----3.92 Pot Cap-1 Maneuver - - 0 - 0 310 Stage 1 - - 0 - 0 - Stage 2 - - 0 - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver -----310 Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach EB WB NB HCM Control Delay, s 0 0 20.4 HCM LOS C Minor Lane/Major Mvmt NBLn1 EBT EBR WBT Capacity (veh/h) 310 - - - HCM Lane V/C Ratio 0.247 - - - HCM Control Delay (s) 20.4 - - - HCM Lane LOS C - - - HCM 95th %tile Q(veh) 1 - - - HCM 6th TWSC 02 - Buildout 2024 Lane Configuration.syn 3: FM 1939 (Randol Mill) & AP 2 10B - Buildout 2024 MID Peak Synchro 11 Report Intersection Int Delay, s/veh 1 Movement WBL WBR NBT NBR SBL SBT Lane Configurations Traffic Vol, veh/h 0 113 959 54 0 718 Future Vol, veh/h 0 113 959 54 0 718 Conflicting Peds, #/hr 0 00000 Sign Control Stop Stop Free Free Free Free RT Channelized - None - None - None Storage Length - 0 ---- Veh in Median Storage, # 0 - 0 - - 0 Grade, % 0 - 0 - - 0 Peak Hour Factor 94 94 94 94 94 94 Heavy Vehicles, % 2 22322 Mvmt Flow 0 120 1020 57 0 764 Major/Minor Minor1 Major1 Major2 Conflicting Flow All - 539 0 0 - - Stage 1 ------ Stage 2 ------ Critical Hdwy - 7.14 ---- Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy - 3.92 ---- Pot Cap-1 Maneuver 0 417 - - 0 - Stage 1 0 - - - 0 - Stage 2 0 - - - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver - 417 ---- Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach WB NB SB HCM Control Delay, s 17.1 0 0 HCM LOS C Minor Lane/Major Mvmt NBT NBRWBLn1 SBT Capacity (veh/h) - - 417 - HCM Lane V/C Ratio - - 0.288 - HCM Control Delay (s) - - 17.1 - HCM Lane LOS - - C - HCM 95th %tile Q(veh) - - 1.2 - Timings 02 - Buildout 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)10C - Buildout 2024 PM Peak Synchro 11 Report Lane Group EBU EBL EBT EBR WBL WBT WBR NBU NBL NBT NBR SBU Lane Configurations Traffic Volume (vph) 21 159 940 202 496 1480 206 54 272 513 369 2 Future Volume (vph) 21 159 940 202 496 1480 206 54 272 513 369 2 Peak Hour Factor 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 0.95 Shared Lane Traffic (%) Lane Group Flow (vph) 0 189 1202 0 522 1775 0 0 343 928 0 0 Turn Type Prot Prot NA Prot NA Prot Prot NA Prot Protected Phases 5 5 2 1 6 3 3 8 7 Permitted Phases Detector Phase 5 5 2 1 6 3 3 8 7 Switch Phase Minimum Initial (s) 5.0 5.0 10.0 5.0 10.0 5.0 5.0 5.0 5.0 Minimum Split (s) 13.0 13.0 53.0 13.0 54.0 13.0 13.0 54.0 13.0 Total Split (s) 23.0 23.0 54.0 35.0 66.0 23.0 23.0 41.0 20.0 Total Split (%) 15.3% 15.3% 36.0% 23.3% 44.0% 15.3% 15.3% 27.3% 13.3% Yellow Time (s) 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 5.0 All-Red Time (s) 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 0.0 0.0 0.0 0.0 Total Lost Time (s) 8.0 8.0 8.0 8.0 8.0 8.0 Lead/Lag Lag Lag Lag Lead Lead Lag Lag Lag Lead Lead-Lag Optimize? Yes Yes Yes Yes Yes Yes Yes Yes Yes Recall Mode None None C-Max None C-Max None None None None Act Effct Green (s) 15.0 47.2 25.8 58.0 15.0 33.0 Actuated g/C Ratio 0.10 0.31 0.17 0.39 0.10 0.22 v/c Ratio 0.55 0.76 0.88 0.91 1.00 0.89dr Control Delay 70.9 49.1 77.9 51.4 114.8 55.6 Queue Delay 0.0 0.0 0.0 0.0 0.0 0.0 Total Delay 70.9 49.1 77.9 51.4 114.8 55.6 LOS ED ED FE Approach Delay 52.0 57.4 71.6 Approach LOS D E E Queue Length 50th (ft) 92 384 257 595 175 284 Queue Length 95th (ft) 135 443 #340 665 #283 340 Internal Link Dist (ft) 657 536 265 Turn Bay Length (ft) 410 430 340 Base Capacity (vph) 343 1578 617 1943 343 1134 Starvation Cap Reductn 0 0 0 0 0 0 Spillback Cap Reductn 0 0 0 0 0 0 Storage Cap Reductn 0 0 0 0 0 0 Reduced v/c Ratio 0.55 0.76 0.85 0.91 1.00 0.82 Intersection Summary Cycle Length: 150 Actuated Cycle Length: 150 Offset: 48 (32%), Referenced to phase 2:EBT and 6:WBT, Start of Green Natural Cycle: 145 Control Type: Actuated-Coordinated Maximum v/c Ratio: 1.13 Intersection Signal Delay: 73.5 Intersection LOS: E Timings 02 - Buildout 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)10C - Buildout 2024 PM Peak Synchro 11 Report Lane Group SBL SBT SBR Lane Configurations Traffic Volume (vph) 257 869 221 Future Volume (vph) 257 869 221 Peak Hour Factor 0.95 0.95 0.95 Shared Lane Traffic (%) Lane Group Flow (vph) 273 1148 0 Turn Type Prot NA Protected Phases 7 4 Permitted Phases Detector Phase 7 4 Switch Phase Minimum Initial (s) 5.0 5.0 Minimum Split (s) 13.0 54.0 Total Split (s) 20.0 38.0 Total Split (%) 13.3% 25.3% Yellow Time (s) 5.0 5.0 All-Red Time (s) 3.0 3.0 Lost Time Adjust (s) 0.0 0.0 Total Lost Time (s) 8.0 8.0 Lead/Lag Lead Lead Lead-Lag Optimize? Yes Yes Recall Mode None None Act Effct Green (s) 12.0 30.0 Actuated g/C Ratio 0.08 0.20 v/c Ratio 1.00 1.13 Control Delay 121.0 122.3 Queue Delay 0.0 0.0 Total Delay 121.0 122.3 LOS F F Approach Delay 122.1 Approach LOS F Queue Length 50th (ft) 140 ~465 Queue Length 95th (ft) #238 #564 Internal Link Dist (ft) 603 Turn Bay Length (ft) 300 Base Capacity (vph) 274 1016 Starvation Cap Reductn 0 0 Spillback Cap Reductn 0 0 Storage Cap Reductn 0 0 Reduced v/c Ratio 1.00 1.13 Intersection Summary Timings 02 - Buildout 2024 Lane Configuration.syn 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd)10C - Buildout 2024 PM Peak Synchro 11 Report Intersection Capacity Utilization 96.0% ICU Level of Service F Analysis Period (min) 15 ~ Volume exceeds capacity, queue is theoretically infinite. Queue shown is maximum after two cycles. # 95th percentile volume exceeds capacity, queue may be longer. Queue shown is maximum after two cycles. dr Defacto Right Lane. Recode with 1 though lane as a right lane. Splits and Phases: 1: FM 1939 (Randol Mill) & FM 1709 (Southlake Blvd) HCM 6th TWSC 02 - Buildout 2024 Lane Configuration.syn 2: AP 1 & FM 1709 (Southlake Blvd)10C - Buildout 2024 PM Peak Synchro 11 Report Intersection Int Delay, s/veh 0.3 Movement EBT EBR WBL WBT NBL NBR Lane Configurations Traffic Vol, veh/h 1494 31 0 2180 0 58 Future Vol, veh/h 1494 31 0 2180 0 58 Conflicting Peds, #/hr 0 00000 Sign Control Free Free Free Free Stop Stop RT Channelized - None - None - None Storage Length -----0 Veh in Median Storage, # 0 - - 0 0 - Grade, % 0 - - 0 0 - Peak Hour Factor 97 97 97 97 97 97 Heavy Vehicles, % 2 22222 Mvmt Flow 1540 32 0 2247 0 60 Major/Minor Major1 Major2 Minor1 Conflicting Flow All 0 0 - - - 786 Stage 1 ------ Stage 2 ------ Critical Hdwy -----7.14 Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy -----3.92 Pot Cap-1 Maneuver - - 0 - 0 288 Stage 1 - - 0 - 0 - Stage 2 - - 0 - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver -----288 Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach EB WB NB HCM Control Delay, s 0 0 20.7 HCM LOS C Minor Lane/Major Mvmt NBLn1 EBT EBR WBT Capacity (veh/h) 288 - - - HCM Lane V/C Ratio 0.208 - - - HCM Control Delay (s) 20.7 - - - HCM Lane LOS C - - - HCM 95th %tile Q(veh) 0.8 - - - HCM 6th TWSC 02 - Buildout 2024 Lane Configuration.syn 3: FM 1939 (Randol Mill) & AP 2 10C - Buildout 2024 PM Peak Synchro 11 Report Intersection Int Delay, s/veh 0.8 Movement WBL WBR NBT NBR SBL SBT Lane Configurations Traffic Vol, veh/h 0 113 1158 55 0 1620 Future Vol, veh/h 0 113 1158 55 0 1620 Conflicting Peds, #/hr 0 00000 Sign Control Stop Stop Free Free Free Free RT Channelized - None - None - None Storage Length - 0 ---- Veh in Median Storage, # 0 - 0 - - 0 Grade, % 0 - 0 - - 0 Peak Hour Factor 90 90 90 90 90 90 Heavy Vehicles, % 2 22222 Mvmt Flow 0 126 1287 61 0 1800 Major/Minor Minor1 Major1 Major2 Conflicting Flow All - 674 0 0 - - Stage 1 ------ Stage 2 ------ Critical Hdwy - 7.14 ---- Critical Hdwy Stg 1 ------ Critical Hdwy Stg 2 ------ Follow-up Hdwy - 3.92 ---- Pot Cap-1 Maneuver 0 341 - - 0 - Stage 1 0 - - - 0 - Stage 2 0 - - - 0 - Platoon blocked, % - - - Mov Cap-1 Maneuver - 341 ---- Mov Cap-2 Maneuver ------ Stage 1 ------ Stage 2 ------ Approach WB NB SB HCM Control Delay, s 21.6 0 0 HCM LOS C Minor Lane/Major Mvmt NBT NBRWBLn1 SBT Capacity (veh/h) - - 341 - HCM Lane V/C Ratio - - 0.368 - HCM Control Delay (s) - - 21.6 - HCM Lane LOS - - C - HCM 95th %tile Q(veh) - - 1.6 - M E M O R A N D U M September 26, 2023 To: Shana Yelverton, City Manager From: Amy Shelley, City Secretary Subject: Resolution No. 23-024, appointing members, and chairs to various positions on the Alliance for Community Engagement, Community Enhancement Development Corporation, Crime Control & Prevention District, Library Board, Metroport Teen Court, Senior Advisory Commission, and the Southlake Arts Council. Action Requested: Approve Resolution No. 23-024, appointing members, and chairs to various positions on the Alliance for Community Engagement, Community Enhancement Development Corporation, Crime Control & Prevention District, Library Board, Metroport Teen Court, Senior Advisory Commission, and the Southlake Arts Council. Background Information: Each year, the City Council appoints members of the public to various boards, commissions and committees. Each member is appointed for a two-year term unless indicated otherwise. Appointed members shall be citizens of Southlake and registered voters. Members of the public indicate their interest to volunteer by submitting a completed application to the City Secretary’s Office. Applications are available on the City’s website and from the City Secretary’s Office. In preparation for the October appointments, Mayor Huffman sent an email to all board and commission members asking for referrals. The City Secretary’s Office also sent an email to board members with expiring terms to determine interest in reappointment to their respective board or interest in a different board. The City Secretary’s Office also publicized the upcoming October appointments with MySouthlakeNews.com, on social media, and in the Volunteer Southlake newsletter that was sent to 1,965 subscribers. On August 16, 2022, the City Council approved Ordinance No. 12228A, relative to the boards, commissions, or committees. This ordinance identifies the following for the Council to make appointments to chair positions: • Building Board of Appeals • Capital Improvements Advisory Committee (only if P&Z is not serving as the CIAC committee) • Library Board • Parks and Recreation Board • Alliance for Community Engagement Item 8A • Senior Advisory Commission • Southlake Arts Council • Southlake Parks Development Corporation • Tax Increment Reinvestment Board • Zoning Board of Adjustment On September 1, 2023, Council received a binder that included applications filed with the City Secretary’s Office for these boards as well as an outline of each board detailing the current membership, terms expiring, and noting existing members who expressed an interest to be reappointed. The boards identified for appointment in October, together with the individual place terms set to expire, are highlighted and listed below. Alliance for Community Engagement (ACE) Term to Expire Request to be reappointed Danny Batsalkin Place 1 October 2023 YES Mark Flores Place 3 October 2023 YES Muhammad Iqbal Place 5 October 2023 YES Mike Kaucher Place 7 October 2023 NO Douglas Lies Place 9 October 2023 YES Elisa O’Callaghan Place 11 October 2023 NO Community Enhancement and Development Corporation Term to Expire Request to be reappointed Jeff Wang Director 1 September 2023 YES Robert Mundlin Director 3 September 2023 YES Crime Control and Prevention District Board Term to Expire Request to be reappointed Ken McMillan Place 1 September 2023 YES Robert Williams Place 2 September 2023 YES Frank Powers Place 3 September 2023 YES Library Board Term to Expire Request to be reappointed Virginia Hinkle Place 3 October 2023 NO Guy Midkiff Place 4 October 2023 NO Tracy Patton Place 7 October 2023 NO Metroport Teen Court Term to Expire Request to be reappointed Devika Seth Southlake Rep. October 2023 YES Senior Advisory Commission Term to Expire Request to be reappointed William Meddings Place 1 October 2023 YES Kathryn Orler Place 3 October 2023 NO Mike Kaucher Place 5 October 2023 NO Greta Schumacher Place 6 October 2023 YES Douglas Lies Alternate 1 October 2023 NO VACANT Alternate 2 October 2022 N/A Southlake Arts Council Term to Expire Request to be reappointed Beatriz Terrazas Place 1 October 2023 NO Julie Doyle Place 3 October 2023 YES Alison Viktorin Place 5 October 2023 YES Tamara McMillan Place 7 October 2023 YES Financial Considerations: Not applicable Strategic Link: C2: Partnerships and Volunteerism - Enhancing the sense of community through the board appointment process by creating opportunities for volunteer involvement. Citizen Input/ Board Review: Not applicable Legal Review: Not applicable Alternatives: None Supporting Documents: Board and Commission applications (previously provided to Council in a binder; updates have also been provided) Resolution No. 23-024 Staff Recommendation: Approve Resolution No. 23-024, appointing members, and chairs to various positions on the Alliance for Community Engagement, Community Enhancement Development Corporation, Crime Control & Prevention District, Library Board, Metroport Teen Court, Senior Advisory Commission, and the Southlake Arts Council. RESOLUTION NO. 23-024 A RESOLUTION OF THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS, APPOINTING MEMBERS TO POSITIONS ON THE ALLIANCE FOR COMMUNITY ENGAGEMENT, COMMUNITY ENHANCEMENT AND DEVELOPMENT CORPORATION, CRIME CONTROL AND PREVENTION DISTRICT BOARD, LIBRARY BOARD, METROPORT TEEN COURT, SENIOR ADVISORY COMMISSION, AND THE SOUTHLAKE ARTS COUNCIL PROVIDING AN EFFECTIVE DATE. Whereas, the City Council appoints members of the public to boards, commissions and committees to serve a two-year term, unless indicated otherwise; and Whereas, each appointee shall be a citizen of Southlake and be a registered voter; and Whereas, the membership and qualifications for each board, commission and committee are identified by City Charter, ordinance, or resolution; and Whereas, the City Council will make bi-annual appointments for Council-appointed boards; and Whereas, the City Council desires to appoint members to positions on the following boards: • Alliance for Community Engagement • Community Enhancement and Development Corporation • Crime Control and Prevention District Board • Library Board • Metroport Teen Court • Senior Advisory Commission • Southlake Arts Council THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS, THAT: Section 1. All the findings in the preamble are found to be true and correct and the City Council does hereby incorporate said findings into the body of this resolution as if copied in its entirety. Section 2. The following citizens are appointed to serve as board, commission or committee members for the stated terms and until their successors have been duly appointed and qualified by Council. ALLIANCE FOR COMMUNITY ENGAGEMENT Name Place Term Expiring ___________ Place 1 October 2025 Place 3 October 2025 ___________ Place 5 October 2025 ___________ Place 7 October 2025 Place 9 October 2025 ____________ Place 11 October 2025 The City Council hereby names _____________ as Chair of the Alliance for Community Engagement. COMMUNITY ENHANCEMENT AND DEVELOPMENT CORPORATION Name Place Term Expiring ___________ Director 1 September 2025 ___________ Director 3 September 2025 CRIME CONTROL AND PREVENTION DISTRICT BOARD Name Place Term Expiring ___________ Place 1 September 2025 ___________ Place 2 September 2025 ___________ Place 3 September 2025 LIBRARY BOARD Name Place Term Expiring ___________ Place 3 October 2025 ___________ Place 4 October 2025 ___________ Place 7 October 2025 The City Council hereby names ______________ as Chair of the Library Board. METROPORT TEEN COURT Name Place Term Expiring ___________ Southlake Rep. October 2025 SENIOR ADVISORY COMMISSION Name Place Term Expiring ___________ Place 1 October 2025 ___________ Place 3 October 2025 ___________ Place 5 October 2025 ___________ Place 6 October 2025 ___________ Alternate 1 October 2025 ___________ Alternate 2 October 2024 The City Council hereby names _____________ as Chair of the Senior Advisory Commission. SOUTHLAKE ARTS COUNCIL Name Place Term Expiring ___________ Place 1 October 2025 ___________ Place 3 October 2025 ___________ Place 5 October 2025 ___________ Place 7 October 2025 The City Council hereby names _________________ as Chair of the Southlake Arts Council. Section 3. This resolution is hereby effective upon passage and approval by the City Council. PASSED AND APPROVED ON THIS, THE 3RD DAY OF OCTOBER 2023. CITY OF SOUTHLAKE, TEXAS ____________________________ John Huffman Mayor ATTEST: _________________________ Amy Shelley, TRMC City Secretary M E M O R A N D U M September 26, 2023 To: Shana Yelverton, City Manager From: Amy Shelley, City Secretary Subject: Resolution No. 23-025, nominating candidate(s) to the Tarrant Appraisal District (TAD) Board of Directors. Action Requested: Approve Resolution No. 23-025, nominating candidate(s) to the Tarrant Appraisal District (TAD) Board of Directors. Background Information: The Tarrant Appraisal District (TAD) is seeking nominations for candidates to serve on the board of Directors. The terms of service for the members of the current Board of Directors will expire on December 31, 2023. Each voting unit may nominate one candidate for each of the five positions to be filled but are not required to make any nomination or may nominate any number up to five. Nominations must be submitted to the Chief Appraiser as a resolution or official action adopted by the City Council by October 15, 2023. The current TAD Board of Directors are: Tony Pompa, Chairman Rich DeOtte, Secretary Joe Ralph Martinez Jungus Jordan Vince Puente, Sr. Wendy Burges, Tarrant County Tax Assessor-Collector In order to be eligible to serve as directors, the nominees must have resided in Tarrant County for at least two years prior to January 1, 2022. They may serve on the governing body of a taxing unit in the County and still be eligible to serve as a Directors. However, an employee of a taxing unit is prohibited from serving as a Director unless that employee is also an elected official of the governing body. A Director may not be related to a person who is in the business of appraising property for property tax purposed or represents property owners for compensation in proceedings in the appraisal district or appraised property for use in a proceeding in the appraisal district or who is employed by the appraisal district. A person is ineligible to serve as a director if the individual or a business in which the individual has a substantial interest, enters into a contract with the appraisal district or enters into a contract with a taxing unit in the district, if that contact relates to the performance of an activity governed by Title I of the Texas Property Tax Code (for example, appraising property for tax purposed or Item 8B determining eligibility for exemptions). A substantial interest exists where the individual and spouse have a combined ownership of at least 10% of the voting stock or shares of a business, or either of them is a partner, limited partner or an office. Based on the 2023 adjusted tax levy, Southlake will have 32 votes to cast for the election, which will take place by December 15, 2023. As of the date of this memo, Southlake has not received any nominations for consideration. This item allows the opportunity for City Council to nominate candidates for the TAD Board of Directors. Financial Considerations: Not applicable Strategic Link: C2: Partnerships and Volunteerism - Enhancing the sense of community through the board appointment process by creating opportunities for volunteer involvement. Citizen Input/ Board Review: Not applicable Legal Review: Not applicable Alternatives: None Supporting Documents: TAD Letter Dated September 22, 2023 Resolution No. 23-025 Staff Recommendation: Approve Resolution No. 23-025, nominating candidate(s) to the Tarrant Appraisal District (TAD) Board of Directors. William Durham Executive Director Interim Chief Appraiser September 22, 2023 «Name» «Title» «Entity» «Address» «City», «State» «Zip» RE: Nomination and Appointment to TAD Board of Directors Dear «Salutation »: The current two-year terms of the five voting members of the Tarrant Appraisal District Board of Directors will expire on December 31, 2023. The first step in appointing voting members for the term beginning January 1, 2023 is calculating the number of votes to which the taxing units are entitled. As required by Section 6.03 of the Property Tax Code, I have calculated and provide in the enclosed list the number of votes for each school district, city, and county entity that is entitled to participate in the appointment process. The next step is nomination of candidates. Taxing units are not required to submit any nominations but, if they choose to do so, the nominations may be made only by a resolution adopted by the governing body and the presiding officer of the governing body must submit the names of the nominees to me before October 15, 2023. To be eligible to serve as a voting member of the Board of Directors, an individual must have resided in Tarrant County for at least the two years immediately preceding January 1, 2024. An individual who is otherwise eligible is not ineligible because he or she is a member of the government body of a taxing unit. Texas law restricts eligibility and conduct of members of governmental bodies such as appraisal districts’ board of directors. In consultation with your attorneys, please review the Property Tax Code and other applicable laws carefully for the details of those restrictions, including definitions of “substantial interest”, “business entity”, “deferred”, “abated”, and other terms used below and for the potential criminal consequences of violating certain restrictions. In summary, the Property Tax Code provides that the following are ineligible to serve as voting members of the Board of Directors: • An individual who has been an employee of the Tarrant Appraisal District at any time during the preceding three years; • An individual who has served as a voting member of the Board of Directors for all or part of five terms since January 1, 2022; • An individual who is an employee of a taxing unit that participates in Tarrant Appraisal District unless the individual is also a member of the governing body or an elected official of a taxing unit that participates in the District; Letter to Taxing Units Appointments to Board of Directors September 22, 2023 2500 Handley-Ederville Road• Fort Worth, Texas 76118-6909 • (817) 284-0024 • www.tad.org • An individual who, directly or through a business entity in which he or she has a substantial interest, is a party to a contract with Tarrant Appraisal District or a taxing unit that participates in the District, if the contract relates to the performance of any activity governed by the Property Tax Code; • An individual who has engaged in the business of appraising property for compensation for use in proceedings under the Property Tax Code at any time during the preceding three years; • An individual who has engaged in the business of representing property owners for compensation in proceedings under the Property Tax Code in Tarrant County at any time during the preceding three years; • An individual who is related by blood or marriage to an individual who is engaged in the business of appraising property for compensation for use in proceedings under the Property Tax Code or of representing property owners for compensation in proceedings under the Property Tax Code in arrant County, if the relationship is within the 1st or 2nd degrees on the following chart; • an individual who owns property on which delinquent taxes have been owed to a taxing unit for more than 60 days after the date the individual knew or should have known of the delinquency unless the delinquent taxes, penalty, and interest are being paid under an installment plan or a suit to collect the delinquent taxes is deferred or abated. When submitting nominations, please include not only the full name of each candidate, but also his or her complete residence address and a current resume. Letter to Taxing Units Appointments to Board of Directors September 22, 2023 2500 Handley-Ederville Road• Fort Worth, Texas 76118-6909 • (817) 284-0024 • www.tad.org From timely submitted nominations, I will prepare and distribute before October 30th a ballot to each taxing unit entitled to participate in the appointment process. The appointment process and schedule set out in Section 6.03 of the Property Tax Code may be summarized as follows: before October 01, 2023 Chief Appraiser calculates numbers of votes and notifies taxing units before October 15, 2023 Governing bodies of taxing units nominate candidates by resolution and send names to Chief Appraiser before October 30, 2023 Chief Appraiser prepares ballot and sends it to taxing units before December 15, 2023 for most taxing units but see the different requirements in section 6.03(k-1) that applies only to “each taxing unit entitled to cast at least five percent of the total votes”, which in this appointment cycle means 250 or more votes on the enclosed list Governing bodies of taxing units determine their votes by resolution and send submit votes to Chief Appraiser before December 31, 2023 Chief Appraiser counts votes, determines which candidates received the most votes, and submits results to taxing units January 01, 2024 new term begins If you have any questions, please do not hesitate to call. Sincerely, ___________________ William Durham Executive Director Interim Chief Appraiser WD:jw Enclosure CC: «CC1» «CC2» TARRANT APPRAISAL DISTRICT Calculation of Taxing Entity Votes in 2023 for Appointment to Board of Directors Per Section 6.03(d) of Texas Property Tax Code Votes School Districts: Aledo ISD 5 Arlington ISD 453 Azle ISD 25 Birdville ISD 162 Burleson ISD 29 Carroll ISD 125 Castleberry ISD 16 Crowley ISD 134 Eagle Mountain/Saginaw ISD 189 Everman ISD 25 Fort Worth ISD 597 Godley ISD 1 Grapevine/Colleyville ISD 194 Hurst/Euless/Bedford ISD 196 Keller ISD 280 Kennedale ISD 22 Lake Worth ISD 18 Lewisville ISD 5 Mansfield ISD 221 Northwest ISD 155 White Settlement ISD 40 Total Schools Cities: 2,895 City of Arlington 194 City of Azle 6 City of Bedford 25 City of Benbrook 15 City of Blue Mound 1 City of Burleson 6 City of Colleyville 17 City of Crowley 9 City of Dalworthington Gardens 2 Edgecliff Village 1 City of Euless 25 City of Everman 3 City of Flower Mound 2 City of Forest Hill 7 City of Fort Worth 623 City of Grand Prairie 59 City of Grapevine 28 City of Haltom City 19 City of Haslet 4 City of Hurst 21 City of Keller 23 City of Kennedale 7 Town of Lakeside 1 City of Lake Worth 3 City of Mansfield 53 City of N. Richland Hills 37 Town of Pantego 2 City of Pelican Bay 1 City of Reno 0 City of Richland Hills 4 City of River Oaks 3 City of Roanoke 0 City of Saginaw 13 City of Sansom Park 2 City of Southlake 32 Town of Trophy Club 1 City of Watauga 10 Town of Westlake 3 City of Westover Hills 3 Westworth Village 2 City of White Settlement 9 Total Cities Other: 1,272 Tarrant County 526 Tarrant County College 307 Total Other 833 Total All 5,000 RESOLUTION NO. 23-025 A RESOLUTION NOMINATING CANDIDATE(S) FOR THE TARRANT APPRAISAL DISTRICT BOARD OF DIRECTORS Whereas, the City of Southlake contracts with the Tarrant Appraisal District (TAD) for setting property valuations; and Whereas, the City of Southlake is entitled to nominate one candidate for each of the five positions on the Tarrant Appraisal District Board of Directors; and Whereas, the terms of the TAD Board of Directors expire December 31, 2023. NOW, THEREFORE, BE IT RESOLVED BY THE CITY COUNCIL OF THE CITY OF SOUTHLAKE, TEXAS, THAT: Section 1. THAT the City of Southlake nominates the following to serve on the Tarrant Appraisal District Board of Directors: ________________ ________________ ________________ ________________ ________________ Section 2. This resolution is hereby effective upon passage and approval by the City Council. PASSED AND APPROVED ON THIS, THE 3RD DAY OF OCTOBER 2023. CITY OF SOUTHLAKE, TEXAS ____________________________ John Huffman Mayor ATTEST: __________________________ Amy Shelley, TRMC City Secretary Case No. SV23-0015 S T A F F R E P O R T September 26th, 2023 CASE NO: SV23-0015 PROJECT: Sign Variance for The Gent’s Place EXECUTIVE SUMMARY: Technology Media Group, on behalf of The Gent’s Place, is requesting approval of variances to Sign Ordinance No. 704, as amended, for the Gent’s Place located at 1201 E. SH 114, Suite 140, Southlake, Texas 76092. DETAILS: The property is located at the southeast corner of the intersection of N. Carroll Avenue and E. SH 114. The applicant is requesting variances for two “push thru” cabinet signs. The western elevation sign requires three variances: one for sign type to allow a “push thru” cabinet sign, one for the sign width exceeding 75% of the building façade, and one for the logo height exceeding the maximum height permitted. The eastern elevation sign requires two variances: one for the “push thru” cabinet sign type and one for the logo height exceeding the maximum height permitted. At the September 21, 2023 Sign Board meeting, the Board voted 4-3 to approve the variances, with Kubiak, Springer, and Driscoll dissenting. The dissenting Board members were primarily concerned with the variance for sign type to allow a “push thru” cabinet sign. Case No. SV23-0015 The requested variances are as follows: Proposed Sign Permitted by Sign Ordinance No. 704, as amended Proposed (SV23-0015) West Elevation – Push Thru Cabinet Sign (Logo) East Elevation- Push Thru Cabinet Sign (Logo) • Sign type - Push thru cabinet signs are prohibited. • Sign width not to exceed 75% of building facade. Permitted 9.06’ • Logo height - 20’’ • Letter height - 16’’ • Sign area – 33 s.f. Section 7.4 (c): If the sign consists of a logo only, the logo may cover 100 percent of the sign and use any color. • Sign type - Push thru cabinet signs are prohibited. • Sign width not to exceed 75% of sign façade. • Logo height – 30’’ • Letter height 35.1’’ • Sign area – 33 s.f. • Sign type - Push thru cabinet sign. • Sign width - 9.88’ • Logo height - 48’’ • Letter height – 8’’ • Sign area – 22.32 s.f. The signage is classified as a logo. • Sign type - Push thru cabinet sign. • Sign width – 9.88’ • Logo height – 48’’ • Letter height – 8.13’’ • Sign area- 22.32 s.f. Case No. SV23-0015 ACTION NEEDED: Consider Approval of Requested Sign Variances ATTACHMENTS: (A) Background Information (B) Vicinity Map Presentation Demonstration and Plans STAFF CONTACT: Peyton Sherman (817)748-8269 Jenny Crosby (817)748-8195 Case No. Attachment A SV23-0015 Page 1 BACKGROUND INFORMATION APPLICANT: Technology Media Group on behalf of The Gent’s Place OWNER: The Gent’s Place PROPERTY SITUATION: 1201 East St. Hwy. 114, #140 Southlake, TX 76092 LEGAL DESCRIPTION: GREENWAY-CARROLL ADDITION Lot 1R CURRENT ZONING: “C-3” General Commercial District HISTORY: October 7, 2014; City Council approved a Master Sign Plan for Carroll Pointe for Chuy’s for attached building signs, the development monument signs, and a blade sign for Chuy’s. (MSP14-003) March 18, 2018; City Council approved an amendment to the master sign plan for Chuy’s to relocate an existing attached sign located on a recessed façade on the east elevation to the adjacent facade at a higher level. The size remained the same. (MSP18-001) December 6th, 2022; City Council granted approval for a series of variances related to a push-thru cabinet sign intended for Capitol Grille. These variances encompassed aspects such as letter height, sign height, sign width, and the sign area. SIGN BOARD: September 21, 2023; Approved (4-3; Kubiak, Driscoll, and Springer dissented), subject to the Staff Report dated September 15th, 2023. CITY COUNCIL: STAFF COMMENTS: City Council approval of the request does not eliminate the requirement for a sign application submittal prior to sign installation. Please contact Seantay Carpenter for sign application processing and pre-install inspection. Seantay can be reached at 817-748- 8215 or scarpenter@ci.southlake.tx.us. Case No. Attachment B SV23-0015 Page 1 The Gent’s Place Sign Variance SV23-0015 SV23-0015 APPLICANT: Technology Media Group on behalf of The Gent’s Place REQUEST: LOCATION: 1201 E. SH 114, Suite 140 Consideration of variances to the Sign Ordinance No.704, as amended, for two attached building signs for The Gent’s Place. Aerial View East Elevation West Elevation Street Setback Existing Building Facade- West Elevation Existing Building Façade- East Elevation Proposed Sign Renderings East ElevationWest Elevation Enlarged Sign View Enlarged Sign West Elevation- Night View Variances Requested- Western Elevation Variances: •Sign type •Sign width not to exceed 75% of the sign façade •Logo height Variances Requested- Eastern Elevation Variances: •Sign type •Logo height SV22-0014: Approved Sign Variances 1201 E. SH 114, Suite 100/110 Variances Approved: •Sign width at 36.2 ft •Sign area at 108.6 sf Proposed | Permitted SV22-0014: Continued 1201 E. SH 114, Suite 100/110 Variances Approved: •Sign width at 9.55 ft Proposed | Permitted MSP18-001: Chuy’s West Elevation Sign Board: March 8, 2018; Approved (5-0) subject to the Staff Report dated March 2, 2018. MSP18-001: Chuy’s East Elevation Sign Board Action September 21, 2023; Approved (4-3) subject to the Staff Report dated September 15, 2023. Questions? Case No. Attachment B SV23-0015 Page 1 39 NORTH CARROLL AVENUESTATE STREET14 36 12 34 29 29 14 49 8 9 S T A T E H I G HW A Y 1 1 4 F R O N T A G E R O A D 32 50 6 6 49 0 50 100 200 Feet Job #: 11092 File Name: A-SP-009.dwg Date: 10/04/13 Drawn by: ELB, MJB, LBOSouthlake, Texas Carroll Pointe SITE PLAN C-3 ZONING 51-75 SPACES PROVIDED TAS REQUIRED ACCESSIBLE PARKING LOT 1: 74 SPACES PROVIDED 3 SPACES REQUIRED 4 SPACES PROVIDED SCALE: 1"=50'-0" KEY MAP: Not to Scale 301-400 SPACES PROVIDED LOT 2: 342 SPACES PROVIDED 8 SPACES REQUIRED 8 SPACES PROVIDED Lot 1R Containing 7.246 Acres Greenway-Carroll Addition Richard Eads Survey, Abstract No. 481 City of Southlake,Tarrant County, Texas SITE: 1201 EAST STATE HIGHWAY 114 SOUTHLAKE, TX OWNER: GREENWAY - CARROLL ROAD PARTNERS, L.P. 2808 FAIRMOUNT STREET, SUITE 100 DALLAS, TEXAS 75201 PHONE: (214) 880-9009 FAX: (214) 880-0188 SITE DATA SUMMARY PROPOSED ZONING ACREAGE - 315,623 SF NUMBER OF PROPOSED LOTS TOTAL GROSS FLOOR AREA MAXIMUM BUILDING HEIGHT 38' 44,052 SF 1 7.246 ACRES TOWN CENTERLAND USE DESIGNATION LOT COVERAGE %13.96% OPEN SPACE AREA 78,922 SF OPEN SPACE %25.01% IMPERVIOUS COVERAGE % IMPERVIOUS COVERAGE AREA 236,701 SF 74.99% C-3 EXISTING ZONING C-3 PROVIDED PARKING 404 SPACESSTANDARD ACCESSIBLE TOTAL 12 SPACES 416 SPACES REQUIRED LOADING 3 SPACES PROVIDED LOADING 3 SPACES TOTAL NET FLOOR AREA 42,768 SF TOTAL FLOOR AREA PER USE 25,661 SF60% RESTAURANT 40% RETAIL 17,107 SF REQUIRED PARKING 257 SPACESRESTAURANT AT 1:100 RETAIL AT 1:200 86 SPACES TOTAL 343 SPACES Greenway Investment Company 2808 Fairmount, Ste. 100 Dallas, Texas 75201 Phone: 214-880-9009 Fax: 214-880-0188 CASE NUMBER: ZA13-065 NOTES: x MECHANICAL EQUIPMENT TO BE LOCATED AT WEST END OF ROOF AND SCREENED BY PARAPETS. TYPICAL AT ALL BUILDINGS. x ALL BUILDINGS TO INCLUDE AUTOMATIC FIRE SPRINKLER SYSTEM. x ALL BUILDINGS TO BE FURNISHED WITH KNOX BOX RAPID ENTRY SYSTEMS x FIRE APPARATUS ACCESS WITHIN 250 FEET OF ALL EXTERIOR PORTIONS OF BUILDINGS. Survey: Production: CLIENT APPROVAL JOB INFORMATION TMG APPROVAL Technology Media Group TSCL# 18750 Certified# E470407, 1262 Viceroy Dr. Dallas, TX, 75247 Regulated by The Texas Department of Licensing and Regulation, P. O. Box 12157, Austin, Texas 78711, 1-800-803-9202, 512-463-6599; website: www.tdlr.texas.gov This sign is intended to be installed in accordance with the requirements of Article 600 of the National Electrical Code and/or other applicable local codes. This includes proper grounding and bonding of the sign. 1208 Viceroy Dr, Dallas, TX 75247 214-267-0535 TMGSigns.com The plans and specifications illustrated in this document are the exclusive property of Technology Media Group (TMG), created for the sole purpose of being used as a tool in helping our customers visualize the scope of a proposed project. Distribution or exhibition of these plans to any party outside of your company, or use of these plans to fabricate a product similar to the designs depicted, is expressly forbidden without written consent from TMG. In the event this should occur, TMG shall seek payment for the time and effort involved in the creation of these designs for your company. Render: Fab: PRJ: Customer is responsible for clearly marking & verifying electricity and providing designated 120V electrical circuit within 6 feet of the sign installation area. TMG Signs is allowed to tie into the designated electrical within 6 feet of the sign. Certificate of Occupancy must match the name on the sign. PLEASE NOTE: Renderings are for placement purposes ONLY. TMG tries to be as accurate as possible but actual placement may vary during install. Render Date: 08/01/2023 Revision Date: 09/06/2023 The Gents Place-South Lake 1201 East St. Hwy. 114, #140 South Lake, TX 76092 Name: Date: QT219839 00000 00000 Page 1 of 2 12’ 1” 41’ 3” EXISTING Qty: Install 2 Signs - Remove 2 Signs Fabrication: • REMOVE OLD SIGN • Install Signs in Location Shown • Pin Mounted - New Pins Required • Connect Electrical • New Power Supplies Needed Sign Type: Front Lit Cabinet Sign Building - NSEW Renders Wall/Fascia .080 Aluminum Painted 476C White LEDs Masonry Screws Power Supply Power Switch 1/2” Clear Acrylic Push Thru Letters 4” .063 Aluminum Returns Painted 476C 108.83”48.00”36.005 SQFT Remove This SignRemove This Sign EXISTING 28’ 9” 41’ 3” PROPOSED PROPOSED PROPOSED11.17”3.76”3.76” Survey: Production: CLIENT APPROVAL JOB INFORMATION TMG APPROVAL Technology Media Group TSCL# 18750 Certified# E470407, 1262 Viceroy Dr. Dallas, TX, 75247 Regulated by The Texas Department of Licensing and Regulation, P. O. Box 12157, Austin, Texas 78711, 1-800-803-9202, 512-463-6599; website: www.tdlr.texas.gov This sign is intended to be installed in accordance with the requirements of Article 600 of the National Electrical Code and/or other applicable local codes. This includes proper grounding and bonding of the sign. 1208 Viceroy Dr, Dallas, TX 75247 214-267-0535 TMGSigns.com The plans and specifications illustrated in this document are the exclusive property of Technology Media Group (TMG), created for the sole purpose of being used as a tool in helping our customers visualize the scope of a proposed project. Distribution or exhibition of these plans to any party outside of your company, or use of these plans to fabricate a product similar to the designs depicted, is expressly forbidden without written consent from TMG. In the event this should occur, TMG shall seek payment for the time and effort involved in the creation of these designs for your company. Render: Fab: PRJ: Customer is responsible for clearly marking & verifying electricity and providing designated 120V electrical circuit within 6 feet of the sign installation area. TMG Signs is allowed to tie into the designated electrical within 6 feet of the sign. Certificate of Occupancy must match the name on the sign. PLEASE NOTE: Renderings are for placement purposes ONLY. TMG tries to be as accurate as possible but actual placement may vary during install. Render Date: 08/01/2023 Revision Date: 09/01/2023 The Gents Place-South Lake 1201 East St. Hwy. 114, #140 South Lake, TX 76092 Name: Date: QT219839 00000 00000 Page 1 of 2 EXISTING Qty: Install 2 Signs - Remove 2 Signs Fabrication: • REMOVE OLD SIGN • Install Signs in Location Shown • Pin Mounted - New Pins Required • Connect Electrical • New Power Supplies Needed Sign Type: Front Lit Cabinet Sign Building - NSEW Renders Wall/Fascia .080 Aluminum Painted 476C White LEDs Masonry Screws Power Supply Power Switch 1/2” Clear Acrylic Push Thru Letters 4” .063 Aluminum Returns Painted 476C 108.83”48.00”36.005 SQFT Remove This SignRemove This Sign EXISTING PROPOSED PROPOSED PROPOSED PROPOSED 11.17”3.76”3.76” Survey: Production: CLIENT APPROVAL JOB INFORMATION TMG APPROVAL Technology Media Group TSCL# 18750 Certified# E470407, 1262 Viceroy Dr. Dallas, TX, 75247 Regulated by The Texas Department of Licensing and Regulation, P. O. Box 12157, Austin, Texas 78711, 1-800-803-9202, 512-463-6599; website: www.tdlr.texas.gov This sign is intended to be installed in accordance with the requirements of Article 600 of the National Electrical Code and/or other applicable local codes. This includes proper grounding and bonding of the sign. 1208 Viceroy Dr, Dallas, TX 75247 214-267-0535 TMGSigns.com The plans and specifications illustrated in this document are the exclusive property of Technology Media Group (TMG), created for the sole purpose of being used as a tool in helping our customers visualize the scope of a proposed project. Distribution or exhibition of these plans to any party outside of your company, or use of these plans to fabricate a product similar to the designs depicted, is expressly forbidden without written consent from TMG. In the event this should occur, TMG shall seek payment for the time and effort involved in the creation of these designs for your company. Render: Fab: PRJ: Customer is responsible for clearly marking & verifying electricity and providing designated 120V electrical circuit within 6 feet of the sign installation area. TMG Signs is allowed to tie into the designated electrical within 6 feet of the sign. Certificate of Occupancy must match the name on the sign. PLEASE NOTE: Renderings are for placement purposes ONLY. TMG tries to be as accurate as possible but actual placement may vary during install. Render Date: 08/01/2023 Revision Date: 09/06/2023 The Gents Place-South Lake 1201 East St. Hwy. 114, #140 South Lake, TX 76092 Name: Date: QT219839 00000 00000 Page 2 of 2 23 7/16"9 1/2"1⁄"1⁄"23 3/16" HOURS OF OPERATION Monday-Thursday 8 am - 8pm Friday 8am - 7pm Saturday 8am - 6pm Sunday Closed Qty: 1 Fabrication: • Contour Cut White Vinyl Sign Type: Door Vinyl Building - NSEW Renders 36.005 SQFT HOURS OF OPERATION Monday-Thursday 8am - 8pm Friday 8am-7pm Saturday 8am - 6pm Sunday Closed PROPOSED ITEM 9B M E M O R A N D U M September 26, 2023 TO: Shana Yelverton, City Manager FROM: Stacey Black, Senior Director of Human Resources SUBJECT: City Council confirmation of the City Manager's appointment of David Miller as the Director of Community Services. Action Requested: City Council confirmation of the City Manager's appointment of David Miller as Director of Community Services for the City of Southlake. Background Information: Chapter 4 of the Southlake Charter requires that "The head of each department shall be a chief, director, or superintendent who shall be appointed by the City Manager subject to the approval of the Council and such chief, director or superintendent shall have supervisory authority and financial control over his/her department." Mr. Miller has over fifteen years of experience in non-profit and municipal executive leadership. He joined the City of Southlake in 2021 as the Deputy Director of Community Services. Before becoming part of the City of Southlake team, Mr. Miller held progressively responsible positions at the YMCA, where he served as Vice President of Membership and Marketing, Director of Strategic Initiatives, and Member Engagement Director. His academic background includes a Bachelor of Arts in General Studies focusing on Business, Volunteer Management, and Communications from the University of North Texas. He also holds a Masters in Theological Studies from Southwestern Baptist Theological Seminary. During his time with the City, Mr. Miller has positively impacted the department's operations and management. He has effectively overseen essential aspects of Community Services, including The Marq, recreation programming, aquatics, marketing, community relations, nature center, tennis center, and more. Notably, he was responsible for overseeing the creation of The Marq capital asset program, implementing the matrix team concept within the department, and leading the SH 114 Urban Design Master Plan September 26, 2023 ITEM 9B Page 2 development project. In addition, he has served as a productive member of the executive leadership team in a deputy role, receiving the City of Southlake Deputy Director of the Year Award in 2022. As the Director of Community Services, Mr. Miller will assume full leadership and management responsibilities for the Community Services department. He will provide guidance and oversight for all department activities, including administration, parks and citywide beautification, recreation and outdoor experiences, hospitality and sales, and community relations. Mr. Miller's appointment will ensure continuity and stability within the organization's management structure. His appointment carries no negative budgetary implications and aligns with the City's commitment to excellence in delivering world-class experiences to a world-class community. With your ratification, Mr. Miller's appointment will be effective on October 4, 2023. Financial Considerations: City Manager Yelverton has extended an offer of promotion to Mr. Miller. There is no negative budget impact. Strategic Link: Performance Management and Service Delivery: Attract, develop, and retain a skilled workforce. Citizen Input/ Board Review: N/A Legal Review: N/A Alternatives: N/A Supporting Documents: Mr. Miller's Resume Staff Recommendation: City Council confirmation of the City Manager's appointment of David Miller as Director of Community Services. DAVID MILLER ______________________________________________________ A proven strategic leader with over 15 years of experience in non-profit and municipal executive leadership. A true passion for service and team development displayed by building authentic relationships and developing leaders capable of executing strategy and delivering a prominent level of service. Vision caster who thrives under pressure and is consistently seeking to grow and develop through new challenges. CRITICAL COMPETENCIES Accountability – Customer Service – Fiscal Resource Management – Results Oriented Strategic Thinking – Creative Thinking/Innovation – Organizational Effectiveness Relationship Building – Coaching and Team Development – Collaborative Leadership Transparency – Responsibility – Authenticity PROFESSIONAL EXPERIENCE City of Southlake January 2021 to Present Deputy Director, Community Services • Serve as the “Chief Operations Officer” of the department by overseeing operations including the Marq Southlake, recreation programming, aquatics, marketing, community relations, nature center, tennis center, pickleball complex and more. • Support the priorities of the City Council and appointed boards and commissions. • Provide support to the City Manager’s office, executive leadership team and deputy directors through a spirit of teamwork, collaboration, service, and participation in city-wide initiatives. • Contribute to city-wide matrix teams, including Governance and EVP by providing guidance and input to employee well-being, engagement surveys and employee appreciation programs. • Actively participate as a member of the emergency operations team responsible for logistics and sheltering for residents in case of emergency. • Oversee development of department budget in areas of oversight, including a 71% cost recovery goal and CEDC revenue target of 4.5 million annually. • Promote alignment with city strategy and values by leading department culture initiatives, including creating departmental matrix teams to create consistencies in safety, training, customer service, and innovation. • Provide direct leadership and guidance to three department managers and up to 200 additional full-time and part-time staff. • Prioritize a world-class level of customer service through close monitoring of NPS, citizen survey and other feedback with a focus on follow-up, responsiveness, innovation, and process improvement. • Model and hold staff accountable to alignment with city mission and values. Projects: Marq Capital Asset Plan: Oversaw the creation of the Marq capital asset plan that is a proactive 20- year replacement strategy for all capital assets in the Marq. This collaborative process involved multiple city departments and resulted in a strong, award-winning plan that will help the Community Services Department maintain a prominent level of service delivery by proactively saving funds to invest back into the facility. Matrix Teams: Worked with department leaders to create, implement and develop four strategic matrix teams designed to align with city strategy and values while also providing employees the opportunity to actively participate in departmental change initiatives. SH 114 Urban Design Master Plan: Worked with design partner Kimley Horn to develop a conceptual master plan for green ribbon and city-funded improvements within the 114 corridor. This collaborative effort included clear communication with the Public Works and City Manager’s Office and resulted in a Council decision to implement green ribbon concepts at four intersections along 114. Special Contributions: Governance Work: Active member of the project team that created an enhanced ethics strategy for city staff and elected officials. Duties included the work on the ethics pledge and program implementation. Business Planning Process: Promoted creating and implementing a new business plan strategy for the department that aligned with the city’s corporate priorities, told the department story, and helped provide a framework for effectively implementing departmental goals and strategy. Deputy Director Collaboration: Worked with the deputy directors to create a collaboration strategy that includes monthly lunches and challenge network touchpoints. This strategy has resulted in better teamwork and collaboration between departments. Pickleball Complex Opening: Developed a comprehensive plan for a successful opening and launch of programming at the Southlake Pickleball Complex. This plan involves multiple City departments and will continue to evolve as the grand opening of the complex draws near. Awards: Marq Capital Asset Replacement Plan: This plan received a TRAPS regional award for excellence in maintenance programming. Deputy Director of the Year 2022: This is a peer-elected annual award. Arlington–Mansfield Area YMCA June 2014 to May 2020 Vice-President, Membership and Marketing • Oversaw all association marketing efforts, including planning and management of monthly membership and program growth campaigns. • Oversaw all graphic design and marketing projects and planned monthly social media calendar for use by all branches. • Oversaw all internal and external communication and public relations messaging. This included the communication strategy surrounding a 3-month COVID-19 shutdown. • Successful communication strategies during COVID-19 shutdown resulted in only a 12% cancellation of overall membership base while still taking monthly drafts. • Member of the Executive Leadership Team that set strategy and vision for the association. • Coordinated with regional and national partners to ensure YMCA messaging was consistent in all areas of service to the local community. • Advised C-Suite leaders on all aspects of membership and marketing related to the association, including hiring, strategic planning, and growth strategies. • Oversaw the Membership Department for the YMCA Association. This included the planning and implementation of policies geared towards member acquisition, recruitment, and retention. • Advised Branch Membership Directors in the development of policies and procedures to achieve their short and long-term goals. • Led project taskforce teams in the development of the following: Membership Referral Program, Corporate Membership Program, and Financial Assistance Program. • Produced association daily and month-end dashboards related to membership growth, loss, and retention and all other key data trends. Special Projects: Community Needs Assessment: Planned, implemented, and directed a community-wide needs assessment comprised of focus groups, town hall meetings, one-on-one interviews, and online surveys. The results of this assessment were used to build our 3-year strategic plan that is currently underway. Membership Business Model: Benchmarked YMCA membership departments across the country to develop a new business model focused on staffing structures and policies/procedures and a realignment of our organizational structure. New Building Design: Helped coordinate the design and launch of a new YMCA Branch. Duties included IT coordination, lobby and AV design, traffic flow, and staff onboarding/training. IT Restructure: Coordinated the restructuring of IT services to all locations including VOIP, data center transfer, network reconstruction, and remote support. Software Implementation: Coordinated all new software implementations. Worked with service vendors and all relevant YMCA departments to ensure acquisition, training, launches and maintenance of all new software programs were successful. This included ongoing training and staff development for all new and current staff. Software programs included: Daxko Operations, Daxko Engage, Outlook, HUD, Daxko Mobile, Daxko Payment Services, and more. Website Redesign: Worked in an interim role within the marketing department to develop a brand-new website that met our strategic needs. Work on this project included site planning, content development, page building, testing, and launching the site. Other Duties: Work with Branch Membership Directors to ensure hiring practices fit within the guidelines of the overall business model. Participated in hiring teams for Branch Directors and Executive Directors, and C-Level employees. Work with CFO to identify opportunities to increase revenue through overall rate increases, program fee changes, and additional membership and program offerings. Director of Strategic Initiatives • Member of the Executive Leadership Team that set strategy and vision for the association. • Advised C-Suite leaders on all aspects of membership related to the association including hiring, strategic planning, and growth strategies. • Oversaw the Membership Department for the YMCA Association. This included the planning and implementation of policies geared towards member acquisition, recruitment, and retention. • Advised Branch Membership Directors in the development of policies and procedures to achieve their short and long-term goals. • Led project taskforce teams in the development of the following: Membership Referral Program, Corporate Membership Program, and Financial Assistance Program. • Produced association daily and month-end dashboards related to membership growth, loss, and retention and all other key data trends. • Assisted Branch Executive Directors and Membership Directors in budget planning, forecasting, and variance reporting. • Coordinated across all departments of service to ensure that membership priorities and strategies were being met within the unique structure of each program area. SKILLS Software: PC, Word, Windows, Excel (NetCom Excel, 1, 2, 3), ACTIVE net, Smartsheet, Daxko Suite, Admarc, AMSI, PowerPoint, Publisher, WordPress, Constant Contact, Survey Monkey. Job Related: Project Management, Strategic Planning, Leadership Development, Staff Development, Training, Standard Operating procedures, Team Leadership, Change Leadership, interdepartmental communication, and collaboration. COURSES Yellow Belt, Green Belt, Reset the clock, Project Management, Intro to Leading Others, Into to Fiscal Management, Intro to Listen First, YMCA Supervision, Intro to the Y’s Cause and Culture, How to Create and Facilitate a Workshop, Facilitator Training for Giving a Cause Driven Tour. EDUCATION University of North Texas B.A. in General Studies: Business and Volunteer Management, Communication Studies Southwestern Baptist Theological Seminary Masters – Theological Studies Certificate - Counseling